KEGG   Methanosaeta thermophila: Mthe_1400Help
Entry
Mthe_1400         CDS       T00417                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1500562..1501572
Genome map
AA seq 336 aa AA seqDB search
MYRDELVERVARRINPREGVCGTCHAIAEEVCATGGSILAYERPSGILARITDDKGEVIG
EGFGIVWSPAVLAAELDAGIVPDDLEDRLRRDGTSSQDIVDKVAALFGYGRVVTPAVIAL
NMVKEMGGRTLIRREGLGVVATFFDSKGDVIASSPSSYCPTCAVTIAAAITPEIADYVKK
TLEGKQNTGKKKLDLGLENRYEIEHGHVRVTLARGDEVLANRVLGCCMAYATVKAEIVAG
LVPQASAEQFKLYCNLCPFKHCWMDKSMGATGNIILQRLTEIGAEIEVSAEGYIVARLAG
EEIEGRGTLCSLSALTNMLLKGDAERILKPSSARRW
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtacagggacgagcttgtggagcgtgttgcgaggaggatcaaccccagggagggcgta
tgcggcacctgccacgcaattgctgaggaggtttgcgccacagggggatcgatcctggca
tacgagcgtccatcaggaatactcgcaaggataacagacgataaaggagaggtgatcgga
gagggttttggaatcgtctggtctcccgcagttctcgcagcggagctggatgcaggcata
gtgccagatgatcttgaggatcgtctcagaagagatggaacgagctcccaggatattgtg
gataaggttgcagcgctcttcggctacggcagggtcgtgaccccagcagtcatcgcgctg
aacatggtaaaggagatgggcgggaggaccctgatcaggcgagaggggctgggcgttgtg
gcgaccttcttcgactcgaagggagatgtgattgcatcatccccttcatcttactgtccg
acatgcgcggtcacgatcgccgccgcgatcacgccggagatcgcagattacgttaaaaaa
acgcttgaggggaagcagaacacagggaagaagaagctggatctcggccttgagaaccgg
tatgagatagagcacggccacgtccgtgtcacccttgcgaggggagatgaggttctggcc
aacagagttctaggatgctgcatggcatacgccactgtcaaggccgagatcgtcgcaggg
cttgtgccgcaggcgagcgcggagcagttcaagctctactgcaacctctgcccgttcaag
cactgctggatggacaagtccatgggcgccacggggaacatcatactccagaggctcaca
gagatcggcgcggagatcgaggtctcggctgagggctacatagttgcaaggctcgcggga
gaggaaatcgaggggcgcggcaccctctgctccctgagcgcactgaccaacatgcttcta
aagggtgacgctgagaggatcctgaagccttcatctgccaggagatggtga

DBGET integrated database retrieval system