KEGG   Methanosaeta thermophila: Mthe_1403Help
Entry
Mthe_1403         CDS       T00417                                 

Definition
(GenBank) methionine adenosyltransferase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00270  Cysteine and methionine metabolism
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mthe_1403
Enzymes [BR:mtp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     Mthe_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AdoMet_Synthase Nup35_RRM_2 AMP-binding_C_2 S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: ABK15178
JGI: Mthe1403
UniProt: A0B904
Position
complement(1503542..1504636)
Genome map
AA seq 364 aa AA seqDB search
MLDTLITFRNFELPRFEVVERKCTGHPDTLADGISESISRELCRIYMEEFGEIMHHNVDK
VLIIGGRAEPQFGGGRILEPPAIVVGGRATSVRSSMSDVVREAASSYLRKAVRHLNEFVV
EPRTREGAPELRSLIGRGANDTSIGSGFAPLRPLESMVLEIDRMLEGMKGVGEDRKIMAV
RFDDRVKVVVAAAAISRYMFSMDDYIEMKSRIRETIQSACDVEVDVNAADHDSNIFLTVT
GTSAEMGDDGATGRGNRANGLITPMRPMTMEAVAGKNPVNHVGKIYNVIAQRAAEDISKL
DGVQEAYVTLVSRIGSPLDQPLMKALSIAGSESAGYEAESILEDWLGRAESLVDEFVSGR
IRIF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgttggatacactcatcacattccgaaactttgagcttcctcgatttgaggttgtggag
agaaagtgcacagggcatccggatacacttgcagatgggatctcagagtcgatatccagg
gagctctgcaggatctacatggaggagttcggggagatcatgcaccacaacgtggacaag
gtcctcatcataggtggaagggcagagccccagttcggaggcggccggatacttgagccg
cctgccatcgtggtcggcggccgggcaacctctgtgagatcctccatgagtgatgtcgta
agagaggctgcgtcctcgtatctgagaaaagctgtaagacacctgaacgagtttgtggtg
gagcccagaacacgggagggggctccagagctgaggagcctcatcggtagaggcgccaat
gatacatccatcggatccgggttcgcgcccctccgaccgctcgaatcgatggtcctggag
atcgaccgcatgttagagggaatgaagggggttggagaggacagaaagatcatggctgtc
aggtttgatgaccgagtgaaggtggttgtggccgcagccgccatctcgaggtacatgttc
tccatggacgattacatcgagatgaaatcccgcataagggagacgatacagagcgcttgc
gatgtggaggtcgatgtcaatgctgcagatcatgattccaacatcttcctcacggtgaca
ggaacgtccgctgagatgggggatgatggcgccacaggcaggggcaaccgcgcgaacgga
ctgatcactccgatgagacccatgaccatggaggcggtcgcgggcaagaaccccgtgaac
cacgtcggcaagatatacaatgtgatagctcagcgcgcagccgaggatatatcaaaactt
gatggtgtccaggaggcatatgtaacgctggtgagtagaatcggctctcctctcgatcag
ccgctcatgaaggcattgagcatcgcaggctcagaaagtgcaggatacgaggcagagtcg
atactggaggactggttgggaagagcagaaagtcttgtagatgagttcgtatccggcagg
atcaggatattctga

DBGET integrated database retrieval system