KEGG   Methanosaeta thermophila: Mthe_1411Help
Entry
Mthe_1411         CDS       T00417                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K07137  
uncharacterized protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1513083..1514447
Genome map
AA seq 454 aa AA seqDB search
MQDVVVVGAGPAGLFAALELSVHGKSVVVVDKGRDISERNCPMKKWGHCLHCEPCHIMCG
MGGAGTYSDGILNLHPAIGGDLTRLTDDPWALVDEVDSVFLRYGAPLETQEPTQNDVEEL
SRRAASVGARFIPIKQRHMGSDRTPEIIREFSNDLKRRGVRFVLNSSAADLIIEKDVCMG
VRLSDGGEIRAESTLLAPGRIGAEWIGEVIERYGIKARYGPLDVGVRVEVPSIVMDPVTR
INRDPKFHIITHRYDDFIRTFCTNPGGFVVKEEYRDFIATNGHSMSGERSENTNFAFLVR
LELTKPIENTTAYGISIAKLVTTIGGRRPVIQRLGDLHRGRRSTGERIARNPVRNTLKDV
TPGDISMALPHRIVMDVIEGLEILNEIIPGVNADSTLLYAPEIKFYAREISVDKDLQTSI
QSLYAAGDGAGLSRGIVAAAATGLLAARGILRGE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgtagtcgtggtcggtgccgggcctgcaggactcttcgcggctcttgagcta
tccgtccacgggaagagcgtggtggttgtcgacaagggcagggacatctctgagaggaac
tgccccatgaagaagtgggggcactgtcttcactgcgaaccctgtcatataatgtgcggg
atgggcggcgctggcacatactcagatggcatactcaatctccatccggcaataggcgga
gatctcacgcgccttacggatgatccatgggctcttgtggatgaggtggactcggtattt
ctgagatatggcgccccccttgagactcaggagcccacgcagaatgatgtggaggagctg
agccggagggctgcatcagtcggtgcgagatttataccgataaagcagcgccacatggga
tccgataggacgcctgagataataagggaatttagcaatgacctcaaaaggcgtggtgtc
aggttcgtgctgaacagctcggcagcagacctcataatagaaaaagatgtgtgcatggga
gtcaggctatcagatggaggagagataagagctgagagcacgctcctcgcgcccggcagg
ataggcgcagagtggatcggggaggtgatcgagagatatggcattaaagcacggtatgga
cctctcgatgtcggggtgcgtgtggaggtgccatcgatagtcatggatcctgtcacgagg
atcaacagagatccgaagtttcacatcataactcacagatacgatgatttcataaggaca
ttctgcacaaaccctggggggtttgtggtcaaggaggagtacagggatttcatagcaaca
aacggacactcaatgtcaggggagcgatctgagaacacgaacttcgcatttcttgtcagg
cttgagctgacgaagccgatagagaacaccacagcatacggaatatcgatagcgaagctc
gtgacaactatcggcgggaggaggcccgtgatccagcggctcggagatctccacaggggg
aggagatcgaccggggagcggatcgccaggaaccctgtcaggaataccctgaaggatgtg
actccgggcgacatatcgatggctctgccccacaggatagtcatggatgtcatcgagggg
cttgagatcctgaatgagatcattccaggagtaaatgctgactccacgctgctttacgcg
ccggagataaaattctacgctcgtgagataagcgtcgacaaagacctgcagaccagcata
caatcactctacgctgcaggcgatggcgccggtctctcgagaggcatagtggcggccgct
gccaccggactgctcgcagcgcgcggaatactcagaggtgagtag

DBGET integrated database retrieval system