KEGG   Methanosaeta thermophila: Mthe_1413Help
Entry
Mthe_1413         CDS       T00417                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1413
   00620 Pyruvate metabolism
    Mthe_1413
   00640 Propanoate metabolism
    Mthe_1413
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1413
   00680 Methane metabolism
    Mthe_1413
Enzymes [BR:mtp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mthe_1413
Lipid biosynthesis proteins [BR:mtp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mthe_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1514971..1516941)
Genome map
AA seq 656 aa AA seqDB search
MVYEKAEVSSQENVYRPASDLVENSNVMQWMKRKGFRSEKELRAWCSENYVEFWDEMAKT
YADWFVPYEKVLEWNPPHARWFVGGKCNVAHNALDRHARSWRRNKVAYYFVGEPVGDTRA
ITYYQLYRDVNKLANGLKSLGVKKGDRVGIYLPMIPELPVAMLACAKIGAIHVVVFSGFS
AGALRERINDAGARVLITCDGSYRRGKPIPIKAQADEALQDAPSVERQIVYRRTGQSIEW
KDGFDIWWHELVKNQPDECETLQMDSEDPLFILYTAGAGGKPRGVVHAHGGFCVGPAYTT
SWVFDIKDTDVYWSTADIGWITGHTYIVYGPLCLGATSVMYEGSPDYPDFGRWFQIIEDY
GVSVIYTAPTAIRMFMKEGEEWPRKYDLRSVRLMGSVGEAMNPDAFLWWRKHVGNDWAPI
MDTWFQSETGCHVIAPLPITPLKPGSPAFPLPGYNVDLLDVNGRAVGPGESGNIVLTAPW
PTMLRGIYGEPEKLREIYYDYYWSIKPGIYLSGDRARRDADGYWWILGRIDDVLKVAGHR
ISNAEVESAALSHPNVADAAVIGRPDKVKGENIILFVVLKEGINPSEELKKDIRNHVRAT
MGPIAMPSEVYFVSAIPKDRTGKPVRAVIKAKALGAALGDTSSVINKDAIDAIPAI
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgaaaaagcagaggtatcctctcaggagaacgtctacaggccggcaagcgac
ctggtggagaactccaatgtgatgcagtggatgaagagaaagggattcaggagtgagaaa
gagctgcgggcctggtgttccgagaactacgttgagttctgggacgagatggcaaagaca
tatgcagattggtttgtgccgtacgagaaggtcctggagtggaacccaccgcatgcgaga
tggtttgtcggaggaaagtgtaacgtcgcgcacaacgccctcgacaggcatgcaagatcc
tggcgaagaaacaaggtcgcttactacttcgtgggtgagccggtcggagataccagggcc
attacatactatcagctctacagagatgtgaataagctcgcaaatggtctgaagagtctt
ggcgtgaagaagggcgacagggttggtatctacctgccgatgatccccgagctgccggtg
gcgatgctggcttgtgctaagatcggcgcgatacatgtcgtagtcttctccggattcagc
gcaggcgcgctccgcgagaggattaacgatgctggggccagagtcctgataacatgtgat
ggatcatacagaaggggcaagcctatcccgataaaggcccaagcggatgaggcccttcag
gacgcgccctctgtcgaacgccagattgtttacagacggactggccagagcatcgaatgg
aaggacggattcgatatctggtggcatgagctcgtgaagaaccagcctgatgagtgtgag
acgcttcagatggactcggaggatccgctcttcatactctacacagctggagctggagga
aagccgaggggtgttgtccatgcgcacggcggcttctgcgtcgggcctgcgtacacgacg
agctgggttttcgacataaaggatactgatgtgtactggtcgactgctgacatagggtgg
atcacaggccacacatacatagtatacggaccgctctgcctcggcgcgacgagcgttatg
tacgagggctctccggattaccctgatttcgggagatggttccagatcatagaggattac
ggtgtctctgtgatatacacagcgcccaccgcaatcaggatgttcatgaaggagggcgag
gagtggcctaggaagtacgacctgagaagcgtccggctcatgggatctgtgggagaggcc
atgaaccccgatgctttcctgtggtggagaaagcatgtcggcaacgactgggctcccata
atggacacatggttccagtcggagacaggatgccatgtgatagctccactgccgataacc
ccgctcaagccgggctcgcctgcattcccgcttcccggatacaacgttgatctccttgat
gtgaacgggagagcagttggtcctggagagagtgggaacatcgtgctcacagccccatgg
ccgacgatgctcagaggtatatacggagagccggagaagctcagggagatctattacgac
tactactggagcatcaaacctggtatatacctcagcggcgacagggcgaggagggatgct
gacggctactggtggatactcggaaggatagatgatgttctgaaggtcgcaggccacagg
ataagcaatgcagaggtcgagagcgcagcgctctcacatccgaatgtcgcggatgcagct
gtcatcggcaggccggacaaggtcaaaggagagaacatcattctcttcgttgtgcttaaa
gagggcatcaatccaagcgaggaactcaagaaggatatcaggaaccatgtcagggcgacc
atgggaccgatagcgatgccctctgaggtttacttcgtctccgccatacccaaggacaga
acgggaaagcctgttagggcagtgatcaaggcgaaggcacttggagcagctctcggcgat
acatcctctgtaataaacaaagatgccatcgatgccatacccgcgatttag

DBGET integrated database retrieval system