KEGG   Methanosaeta thermophila: Mthe_1420Help
Entry
Mthe_1420         CDS       T00417                                 

Definition
(GenBank) LSU ribosomal protein L10P
  KO
K02864  large subunit ribosomal protein L10
Organism
mtp  Methanosaeta thermophila
Pathway
mtp03010  Ribosome
Module
mtp_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Mthe_1420
Ribosome [BR:mtp03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Mthe_1420
  Bacteria
    Mthe_1420
  Archaea
    Mthe_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L10 Ribosomal_60s FliT
Motif
Other DBs
NCBI-ProteinID: ABK15195
JGI: Mthe1420
UniProt: A0B921
Position
complement(1523101..1524066)
Genome map
AA seq 321 aa AA seqDB search
MSADVRHGARVPEWKLREVDELVERIRSSRVVGVAGIRELPADEFQRLRGLLRPISEVRV
VNNNIARRAILKSDESIRPLVDYIEDQTALIFSDANPFALKKMLDAEKRPMPIKAGAVAP
VDIVVESGETSFSPGPMVGKLQSAGIPAAIKGGKVVINQRVVLAKQGDVITPKVAEVLKL
MEIYPKLVGLELRAAYSDRLVFTAEDLAVDTEAVLRDISEAAGKALAFAVEIAYVTPQTV
SPIIQRAASRAMYLVAERGIPVPGMMDLVIMKAHANAQAIAGLMSPGGSAPEQRQVEEVV
EEVEEKKEEEDAAAGLGSLFG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagatgttcgccacggcgctcgtgtgcctgaatggaagctgagagaagtggat
gagctggtggagcgcataagaagcagccgtgtcgtaggcgtcgcgggtatacgcgagctc
ccggcagatgagttccagaggcttcgcggcctcctgaggcccatctctgaggtaagggtt
gtcaacaacaacattgcccggcgggccatactgaagtcggatgagtccatcaggccgctt
gtggattacattgaggatcagacagctctgatattctcagatgcgaatccgtttgcactc
aagaagatgctggacgcagagaaacgcccgatgcccataaaggccggtgctgttgcgccc
gtggatatagtggttgagagcggagagacgtctttctcaccaggaccgatggtcgggaag
ctccagagcgctggaatacctgctgccataaaaggtggcaaggttgtgataaaccagagg
gtggtgctcgcaaagcagggcgatgtgataacaccgaaggtggcagaggtcctcaagctc
atggagatctatccgaagcttgtgggcctggagctccgggcagcttacagcgacaggctg
gttttcactgcagaggatctggcagtggatacggaggcagttctgagggatatatctgag
gctgctggaaaggcgcttgccttcgcagtcgagatagcctatgtgacgccccagaccgta
tctccgatcatccagcgtgcagcatcaagggcgatgtatctggtggccgagcgcggaata
cccgttcccggcatgatggatcttgtcataatgaaggcacatgccaatgctcaggcgatc
gcaggtctgatgtccccaggggggagcgcgccggagcagcggcaggtcgaagaggtcgtt
gaagaagtagaggagaagaaggaagaagaggacgcagccgccgggctgggttctctgttt
ggttaa

DBGET integrated database retrieval system