KEGG   Methanosaeta thermophila: Mthe_1425Help
Entry
Mthe_1425         CDS       T00417                                 

Definition
(GenBank) histone deacetylase superfamily
  KO
K04768  acetoin utilization protein AcuC
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-ProteinID: ABK15200
JGI: Mthe1425
UniProt: A0B926
Position
1526222..1527334
Genome map
AA seq 370 aa AA seqDB search
MIYLYYTDMFMGYSFGPEHPLQPARIMLTYRMIEEYGFFLGYDTEVQMPYYASEDDLLMV
HDPGYIQAVKEERPDPALGLDEPDTPVFPGIYDASALIAGASIEAAKRVASEPCVAFNLA
GGLHHAFPARAAGFCVFNDCALGIRTLRKRFDRVLYIDIDAHHGDGVQYIFYEDPSVLTI
SIHESGKYLFPGTGFVDEIGSGDGYGYSANIPMPLNADDECYRYAFESVIPALFRWFKPD
AVVAQLGVDTHYADPLASLDLTLEGYGYLVRRIKELTDEYAAGRMLALGGGGYNLEVVPL
AWTLAFQTLRGEKMPEELPKWWVDAIMKMIGRPPISLPDRPKKKSDVPRELIETVANLKR
RLTIIHGDIF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatctatctatactatacagatatgttcatgggctacagcttcggccctgaacacccg
ctgcagcctgcgcggatcatgcttacctacaggatgatcgaggagtacggtttcttccta
ggatacgacacagaggttcagatgccgtactatgcaagcgaggatgacctcctcatggtc
cacgatccagggtatatccaggcggtgaaggaagaacggccagatccagcgcttggcctg
gacgagcccgacactccagtattcccaggcatctacgacgccagcgcgttgatcgctgga
gccagcattgaggccgcgaagcgtgttgcatcagagccctgtgtggcgttcaacctcgcc
ggcggtctccatcacgcgtttccggccagagcagcaggattctgcgttttcaacgattgc
gctctcggaattcgcacactgaggaagcgcttcgacagggttctctacatagatatcgat
gctcatcacggcgatggtgtgcagtacatcttctatgaggatccatcagtactgactata
tccatccacgagtctggaaagtacctctttcccggaactggattcgtggacgagatcggc
agcggcgatgggtatgggtactccgcgaacataccgatgccgctgaatgcggatgatgaa
tgctacaggtacgccttcgagtctgtcatccccgcgctgttcagatggttcaaacctgat
gcagtcgtcgcgcagctcggcgtcgatacgcattatgcagatccccttgcgagcctcgat
ctgacgcttgaaggctacggctatctcgttcggaggataaaggagctcacagatgagtat
gcggccggcaggatgctcgccctgggcggaggcggctacaacctggaggtcgtgccgctt
gcatggacgctggcattccagactttgagaggggagaagatgccagaggagctcccgaag
tggtgggttgatgcgataatgaaaatgatcggaagaccacctatatctcttccggatcga
ccaaagaagaagagcgatgtcccaagggagctgatcgagaccgtggcaaacctgaaaaga
aggctgaccataatacacggcgacatattctga

DBGET integrated database retrieval system