KEGG   Methanosaeta thermophila: Mthe_1426Help
Entry
Mthe_1426         CDS       T00417                                 

Definition
(GenBank) N(2),N(2)-dimethylguanosine tRNA methyltransferase
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
mtp  Methanosaeta thermophila
Brite
Enzymes [BR:mtp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     Mthe_1426
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     Mthe_1426
Transfer RNA biogenesis [BR:mtp03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    Mthe_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRM Met_10 Cons_hypoth95 Methyltransf_25 MTS
Motif
Other DBs
NCBI-ProteinID: ABK15201
JGI: Mthe1426
UniProt: A0B927
Position
1527350..1528402
Genome map
AA seq 350 aa AA seqDB search
MVVEGSVRVNTDGVFYNPRMKTNRDICVAMASELGVNEYLDAFSASGIRGIRVRKEAGVE
RVVMNDISPSACRRIRENLALNDISDCEVTCESASALMSRRRFEAIDLDPFGSPAQFLAP
AASSARSYLFITATDTAPLCGAHLKSGVRKYLAVPLNTEYHREMGVRILMGAVIREMARV
DRRGIPLLSYATEHYVRVHMRIKKGAREADEALESMGYVEHCFGCGGWSLRMGMGCRSSG
TCSFCGGRTCTAGPLWLGPLHDKDLLRASLKRLDPESRAHRLVLLCSEEIDVPFYYDHHK
ICRRLRITPSKVEKVISDLLEHGYRASRTHFNGVGIKTDAPMGDLISLLA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggaaggctcggtcagggtgaatacagacggggtcttctacaatccaagaatg
aaaacgaacagggacatctgcgtcgcgatggcatcggagctcggggtaaatgagtatctg
gatgcgttctctgccagtggcatacgcgggatcagagtcagaaaagaggcgggtgtcgag
cgcgtcgtgatgaacgacatcagcccttcagcgtgcaggcgcatcagggagaaccttgcc
cttaatgacatatcggactgtgaggtgacatgcgagagcgccagtgctctcatgagcagg
agacggtttgaggcgatcgatctcgatccattcggctccccagcccagtttctcgctcct
gcagcatcctccgccagatcgtatctcttcataacagccacggataccgctccgctctgc
ggggcacatctcaaaagtggtgtgaggaagtatctcgcagttcctctgaataccgagtac
cacagggagatgggtgtgcggatcctgatgggagctgtaatacgggagatggcgagggtg
gacagacggggcatacctctgctctcgtatgccacagagcactatgttcgagtgcatatg
cgcatcaaaaaaggtgcgcgtgaggctgatgaggcacttgagtctatgggatacgtcgag
cactgtttcggttgtggcggctggagtctgagaatgggcatgggctgcagatcctccggc
acatgcagcttctgcggggggagaacgtgcaccgcagggcctctctggctcggcccgctg
catgataaagatctgctaagagcatctctgaaaaggcttgatcctgagagcagggcccac
agattagtattactatgctctgaggagattgatgtgccgttctactatgatcatcataag
atatgcaggaggctgagaatcacgccttccaaggttgaaaaagtcatatcggatctgctt
gagcatggctacagagcttccaggactcacttcaatggagttggtataaagaccgatgcc
cctatgggggatctgatttctctactcgcctga

DBGET integrated database retrieval system