KEGG   Methanosaeta thermophila: Mthe_1427Help
Entry
Mthe_1427         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1528669..1528998
Genome map
AA seq 109 aa AA seqDB search
MRLLIYFLLGGIITALVVHLGSSGRGTLSAFIATFPVLTALTFILISMEGSSADFCEYAR
GLLIFTPAWIAYVLTVLITFERIGVWLSIALGMVVYAVASWLLRVAIIH
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctgatatacttcttgcttggtgggatcatcacagcgctcgtcgtccatctc
ggcagctcgggccgcgggacgctctcagcgttcatcgccacgtttccagtgctcacagcc
ctcacattcatactgatatccatggagggaagcagcgctgatttctgcgagtatgcgaga
ggccttcttattttcacgcctgcctggatcgcatatgtactgactgtgctgatcaccttt
gaacgcattggcgtttggctatcaatagcattgggtatggtggtatatgcagtggcgtcg
tggcttctgagggttgccatcatccactaa

DBGET integrated database retrieval system