KEGG   Methanosaeta thermophila: Mthe_1436Help
Entry
Mthe_1436         CDS       T00417                                 

Definition
(GenBank) Protein of unknown function DUF1621
  KO
K09152  
uncharacterized protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1536012..1536371
Genome map
AA seq 119 aa AA seqDB search
MVKFLERLMGRPPTDEYVEVDLGQFEDEPERPRAYLRVAELTSLDVLPEIKQEIRSQNIL
LIDIAPMKRDKASLDRAIGELRKIVEDMAGDIAGVGDDLVIIVPSGIRIDREKVVGGKD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagttccttgaaagactgatgggtaggccacccacagatgaatacgtggaggtg
gaccttggccagttcgaggatgagcctgagcggccgagggcttatctcagagtggccgag
ctcacgtccctcgatgtgctgccggagataaagcaggagattcgatcccagaatatactg
ctgattgatatagcgcccatgaagagagacaaggcatctctggacagggcgataggtgag
cttaggaagatcgtcgaggatatggccggggatatagctggagttggagatgatctggtc
ataatagttccgagtggtataagaatcgacagggagaaggttgtgggaggaaaagattga

DBGET integrated database retrieval system