KEGG   Methanosaeta thermophila: Mthe_1450Help
Entry
Mthe_1450         CDS       T00417                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mtp  Methanosaeta thermophila
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1550456..1551016
Genome map
AA seq 186 aa AA seqDB search
MIWMEIARFGKKLVEQGLTGSRFGNISVLTEDGIIITCTGSMLDDIDERQVVLVERDGEC
ADDSLASCETPVHRAIYRSTDARAVIHTHSPYAVALSLLEDVVMPIDSEGIAFLGEMPVV
DGQFGSEKLASAVSDALMDHRACIARGHGVFAKGGDLRDAYITASMAEHSSKIRYLVRWG
RVAPKD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatctggatggagattgccaggttcgggaaaaagcttgttgagcagggtctgaccggc
tcgcgcttcggcaacatctcggtgctgactgaagatgggataattataacatgcaccggc
tccatgctcgacgatatcgacgagagacaggtggtgcttgttgagagagacggagagtgt
gccgatgacagcctcgcgagctgtgagaccccggttcacagagccatataccgcagcaca
gatgccagagcagtgatacacacccattccccttacgctgtggcgctatcgctcctggaa
gatgttgtgatgccaatcgacagcgaggggattgcatttctgggcgagatgcctgtggtc
gacggccagttcggcagcgagaagctcgcctccgccgtatccgatgctctcatggaccac
agggcatgcatcgcgcgcggccacggagtcttcgccaaaggaggagacctgagagatgcg
tatatcacagcatcaatggctgagcacagctccaaaataagatatctggttagatggggg
agggttgcgcccaaagactga

DBGET integrated database retrieval system