KEGG   Methanosaeta thermophila: Mthe_1456Help
Entry
Mthe_1456         CDS       T00417                                 

Definition
(GenBank) ABC transporter related protein
  KO
K09810  
lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
mtp  Methanosaeta thermophila
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mthe_1456
Enzymes [BR:mtp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Mthe_1456
Transporters [BR:mtp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    Mthe_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1558233..1559003)
Genome map
AA seq 256 aa AA seqDB search
MDPVIDRQSNRTIIEIRDLTKIYSDGVKVVALDHINLTIKEGEFLAIVGPSGSGKSTLLN
MIGLLDTPTNGTILLKDIDVTKISANERARLRNRELGFVFQYHHLLPEFTAVENVMMPML
IAGVERKEARERATALLKEVGLGDRLDHKPSQLSGGQNQRVAVARALANRPSIVIGDELT
GNLDTKTSRMIYEMLRELNKKINQTFILVTHDMEMAEKTDRILRLVDGRIVCELRRVGDE
FVSGEICSAETSSDQE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatccggttatagatagacagagcaacagaaccatcatagagataagagacctgacc
aagatatacagtgatggtgtgaaggtggtggctctcgatcacataaatctcacgataaaa
gagggtgagtttctggcgatagttgggccgagcggatccgggaagtcgacgctcctgaac
atgataggccttctcgatacccccacaaacggaacgatactgctgaaagatatcgatgtc
acgaagatcagcgcgaatgagcgggcgaggctgagaaacagagagctgggttttgtcttc
cagtaccatcatctcctccccgagttcacagctgtcgagaacgtgatgatgcccatgctc
atagcaggggtcgagagaaaagaagcgcgcgagcgtgctacggctcttctcaaggaggtc
ggccttggagaccggctcgatcacaagcccagccagctcagcggtgggcagaaccagagg
gttgcggtcgcaagagccctggcgaacaggccatctattgtcataggggatgagctcacc
ggaaacctggacacaaagacatcaaggatgatctatgagatgctcagagaactgaacaag
aagatcaaccagacgttcatcctcgtgacgcatgacatggagatggcggagaagactgat
cgcatactcagactggtggacggaaggatcgtctgtgagctcaggcgggtcggcgatgag
ttcgtgagcggagagatatgctcagcggaaacgagcagcgatcaagaataa

DBGET integrated database retrieval system