KEGG   Methanosaeta thermophila: Mthe_1468Help
Entry
Mthe_1468         CDS       T00417                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mtp  Methanosaeta thermophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mthe_1468
Enzymes [BR:mtp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mthe_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1574756..1576012
Genome map
AA seq 418 aa AA seqDB search
MTIEGELGRLRVGDAYSVRLMGVINLSAESFYKGSVSTPERAASFAIKMADEGAEVIDVG
AVSTAPGSPFISEDVERERLFPALENILDSVDAEVSVDTQRASIADLALSMGAACINDVS
CLKDPSMAEVVADHGASLLLMASRDKPGDILELKDIIPRLAAAVSTAVESGVDPRRILID
PGIGRWIPEKTYEYDLAILDRMRSLRSLRKPIVAAVSRKSFIGAVLGLKDPADRLTGSIA
ATAIAVYNGAHVVRTHDVAACRDAVRIAQAARGMQMPSGRVELLQLTGSAEELRCILDWV
EVDPGAYDILWRKGSFIVVAVEDITPMEALVIKQEMLAAGGDAAVPRGALRCDPSADRAV
IFGTLAQIERLVRKLRLQPFGLPAIASEIESVLSTDASRYKVTEDVTASSRQQSKGRG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatagagggtgagctgggcaggttgcgggtcggagacgcttattccgtcaggctg
atgggggttatcaacctgagcgccgagtcgttctacaagggatccgtctccacgcccgag
agagcggcctcattcgccatcaagatggcagacgagggcgccgaggtgatagacgtcgga
gcagtctccacagcgcccggctcccccttcatctcagaggatgtggagcgcgagaggctt
ttccccgctcttgagaacatactggacagcgttgatgctgaggtgtctgtggacacccag
agggcatcgatagcggatcttgccttgtcgatgggtgcagcctgcatcaatgatgtatcg
tgtcttaaagatccctcaatggcagaggtcgttgcagatcacggggcatcgcttctactc
atggcctctagagataagcctggggatatcctggagctaaaggatatcatcccgaggctc
gcggcggctgtcagcactgctgtggagagtggggtcgacccgaggaggattttgatcgat
cctgggatcggcaggtggattcctgaaaagacctacgagtacgatctcgcaattctcgat
cggatgagaagcctgcgctcactgaggaagccgatcgtcgcggcagtctccagaaagtct
ttcatcggtgcggttctcggtctgaaagaccccgctgataggctgacaggatcgatagct
gcgacggcaatcgctgtttacaacggtgctcatgttgtcaggactcatgatgtcgctgcc
tgcagggatgctgtcaggatagcccaggctgcacgcggaatgcagatgccctccggcagg
gtggagcttctccagctcacaggctcagccgaggagctaagatgcatcctggactgggtt
gaggtcgatccgggagcttatgatatcctctggaggaagggctcgtttattgtagttgct
gttgaggacataaccccgatggaggcattggttataaagcaggagatgcttgcagcgggt
ggagacgctgcggtgcccagaggcgctctgaggtgcgatccatccgcagacagagctgtg
atattcggaacgctggcccagatcgagaggcttgtaaggaagctcaggcttcagccgttc
ggcctgccggccatcgcgagcgagatcgagtcagttctctccacagatgcgagcagatac
aaggttactgaagatgtaaccgcgtcatccagacagcagagcaagggaaggggatga

DBGET integrated database retrieval system