KEGG   Methanosaeta thermophila: Mthe_1543Help
Entry
Mthe_1543         CDS       T00417                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01130  Biosynthesis of antibiotics
mtp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_1543
Enzymes [BR:mtp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mthe_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth Dus TgMIC1 NanE
Motif
Other DBs
NCBI-ProteinID: ABK15314
JGI: Mthe1543
UniProt: A0B9E0
Position
1674192..1674938
Genome map
AA seq 248 aa AA seqDB search
MHPLIEGILSATELRMAGAKQSFDHLKSRDLVGSAISARRRGLIPVIAEIKPRAISRPLR
AGEAGEIARFYESRGACGISVLTEPTYFLGSISSLEEARRSTSLPVLRKDFIINRKQIRE
ARADLVLLIVSIADIEDLIEDVRAAGMEPLVEVHDEHELDRAANAGATIVGINNRDLITL
EVDLGRFEALGPIARDIGLFTVAESGVSSREEALRMMNAGADALLIGNSIMKNPALLGEI
TGVDIKAT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctctcatagagggaatactgagcgctacagagctgcggatggccggagcgaaa
cagtcgtttgatcacctgaaatccagagatctcgtgggctccgcgatctcggcgaggcgc
agaggcctgataccggtgatagccgagataaagccgcgggcgatatccaggccattgagg
gcaggcgaggccggggagatagcgagattttatgagagcaggggcgcctgcggcatctcc
gttctcacagagcccacatacttcctcggctcgatctcatctctggaggaggcgaggaga
tcgacatccctgccggttctcagaaaggacttcatcattaacagaaaacagattcgcgaa
gcccgggcggatctagtgctcctgatcgtatcaatagcagatatcgaggatctcatagag
gatgtcagggcggctggaatggagcctcttgtcgaggttcacgatgagcatgagcttgat
agagccgcaaatgctggcgccacgatagttggaataaacaacagggatctcataactctg
gaggtggatctgggaaggttcgaggctctcggtccgatcgcaagagatatcggtctgttc
acagtcgccgagagtggagttagctcgcgagaggaggcgctgagaatgatgaatgcaggc
gctgatgcgttactcatcgggaactcgataatgaaaaaccccgcgctgctgggagagata
actggggtggatatcaaggccacgtag

DBGET integrated database retrieval system