KEGG   Methanosaeta thermophila: Mthe_1543Help
Entry
Mthe_1543         CDS       T00417                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtp  Methanosaeta thermophila
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mthe_1543
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_1543
Enzymes [BR:mtp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mthe_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1674192..1674938
Genome map
AA seq 248 aa AA seqDB search
MHPLIEGILSATELRMAGAKQSFDHLKSRDLVGSAISARRRGLIPVIAEIKPRAISRPLR
AGEAGEIARFYESRGACGISVLTEPTYFLGSISSLEEARRSTSLPVLRKDFIINRKQIRE
ARADLVLLIVSIADIEDLIEDVRAAGMEPLVEVHDEHELDRAANAGATIVGINNRDLITL
EVDLGRFEALGPIARDIGLFTVAESGVSSREEALRMMNAGADALLIGNSIMKNPALLGEI
TGVDIKAT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctctcatagagggaatactgagcgctacagagctgcggatggccggagcgaaa
cagtcgtttgatcacctgaaatccagagatctcgtgggctccgcgatctcggcgaggcgc
agaggcctgataccggtgatagccgagataaagccgcgggcgatatccaggccattgagg
gcaggcgaggccggggagatagcgagattttatgagagcaggggcgcctgcggcatctcc
gttctcacagagcccacatacttcctcggctcgatctcatctctggaggaggcgaggaga
tcgacatccctgccggttctcagaaaggacttcatcattaacagaaaacagattcgcgaa
gcccgggcggatctagtgctcctgatcgtatcaatagcagatatcgaggatctcatagag
gatgtcagggcggctggaatggagcctcttgtcgaggttcacgatgagcatgagcttgat
agagccgcaaatgctggcgccacgatagttggaataaacaacagggatctcataactctg
gaggtggatctgggaaggttcgaggctctcggtccgatcgcaagagatatcggtctgttc
acagtcgccgagagtggagttagctcgcgagaggaggcgctgagaatgatgaatgcaggc
gctgatgcgttactcatcgggaactcgataatgaaaaaccccgcgctgctgggagagata
actggggtggatatcaaggccacgtag

DBGET integrated database retrieval system