KEGG   Methanosaeta thermophila: Mthe_1587Help
Entry
Mthe_1587         CDS       T00417                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mthe_1587
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mthe_1587
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mthe_1587
Enzymes [BR:mtp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mthe_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1719364..1720710)
Genome map
AA seq 448 aa AA seqDB search
MSNLMFYSTNGSPERVDFREALLSGQAPDMGLYMPEEIPRIGTEEIVRFSKMRYPEIAYR
VVGPYIGDLIPKEDLVSILEDAYNFDVPIERVFDRAHIMRLDRGPTCSFKDFAARLMGRL
VQYFLEREGRSVIILTATSGDTGSAVAHAFYGLSNVQVVVLYPRDEVTERQRKQMTTLGG
NVHALAVDGKFDDCQALVKRAFADPELRDLNLSSANSINVGRLLPQAVYYFYAYSRISEG
EEIVISVPSGNFGNLMGGLIAMRMGLPVRRFVVATNENDEFPVFMRTGIYKPIRPSRNCI
SNAMNVGHPSNLARVFALYGGWLDEKGEVRREPDLDAMRRDMFAVSVSDDETRKTIKEVY
ERYRVLLEPHGAVGWAGLMRYFEEVERWEPTVSLETADPAKFPEEIIRVLGVTPPLPRAM
AELDSLEEHIKEISGSYESLKSYLRGLR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatcttatgttttacagcacaaatggctcgcctgagcgtgtcgacttcagggag
gccctgctatcgggccaggctccagatatgggcctttacatgcccgaggaaatccccagg
atcggcacagaggagatcgtgcgtttctcgaaaatgaggtatcctgagattgcgtaccgc
gttgtgggtccctatatcggcgatctcatccccaaggaggatctcgtatcgatactggag
gacgcatacaacttcgatgttccgatcgagagggttttcgacagggcgcacatcatgcgc
ctggaccgcgggcctacatgctccttcaaggattttgctgccaggctgatgggcaggctc
gttcagtacttcctggagcgagaggggaggagtgtgatcatactgaccgcgacttcagga
gacaccggcagtgccgtggcccatgcgttctacggcctgagcaacgttcaggttgtcgtt
ctatacccacgagatgaggtcactgagcggcagaggaagcagatgacgacgcttggcgga
aatgtacacgctctggcggtggatggcaaattcgatgactgccaggctcttgtcaagaga
gcattcgcagatccggagctgagagacctcaatctgtcatcagcgaactcgataaacgtc
gggaggcttctgcctcaggcagtctactacttctacgcatactccaggatctctgaagga
gaggagatcgtcatatctgtgccgagcggcaacttcggcaacctgatgggtggtctcata
gcaatgcggatggggctgcccgtgaggcgcttcgtcgtcgccacgaacgagaacgatgag
tttccggtcttcatgcgcacaggcatctacaagcctataagacccagcaggaactgcatc
tcaaatgcgatgaatgtgggccatccgagcaacctcgccagggtgttcgcgctttacggc
gggtggctggatgagaagggtgaggtgaggagagagccggatctcgatgcaatgcgtagg
gacatgttcgcggtctcggtgagcgatgatgagacgagaaagacgataaaagaggtgtac
gagcgttacagggtgctcctggagccacacggagccgtcggatgggcagggctcatgagg
tacttcgaggaggtcgagcgctgggagccgacagtctcgctggagaccgcggatcccgcg
aagttcccggaggagatcatccgcgttcttggagtgacgcccccgctcccgagggcgatg
gcagagctcgacagcctggaagagcatatcaaggagataagcggatcctacgagtccctg
aaatcatatctcagaggtctgcgatga

DBGET integrated database retrieval system