KEGG   Methanosaeta thermophila: Mthe_1647Help
Entry
Mthe_1647         CDS       T00417                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00010  Glycolysis / Gluconeogenesis
mtp00020  Citrate cycle (TCA cycle)
mtp00620  Pyruvate metabolism
mtp00633  Nitrotoluene degradation
mtp00640  Propanoate metabolism
mtp00650  Butanoate metabolism
mtp00680  Methane metabolism
mtp00720  Carbon fixation pathways in prokaryotes
mtp01100  Metabolic pathways
mtp01120  Microbial metabolism in diverse environments
mtp01130  Biosynthesis of antibiotics
mtp01200  Carbon metabolism
Module
mtp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1647
   00020 Citrate cycle (TCA cycle)
    Mthe_1647
   00620 Pyruvate metabolism
    Mthe_1647
   00640 Propanoate metabolism
    Mthe_1647
   00650 Butanoate metabolism
    Mthe_1647
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1647
   00680 Methane metabolism
    Mthe_1647
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mthe_1647
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mthe_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_9 Fer4_6 Fer4_17 Fer4_2 Fer4_7 Fer4_16 Fer4_10 Fer4_4 Fer4_13 Fer4_8 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ABK15414
JGI: Mthe1647
UniProt: A0B9P0
Position
complement(1791749..1792006)
Genome map
AA seq 85 aa AA seqDB search
MKITVAALTEPGSTIVNKTGAWRTFVPVVNHKRCIKCSLCEIYCPEGCIHQIDGLFVPDL
DYCKGCGVCAHECPRKAIDMVLEEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaagataacagttgcagctctgacggagccaggcagcactattgtaaacaagaccgga
gcgtggcgcacattcgttccggttgtgaatcacaagagatgcataaagtgcagcctctgc
gagatttactgccctgaggggtgtatacatcagatcgacggactgttcgttccagatctg
gattactgcaagggatgcggggtctgcgctcatgagtgccccagaaaggcgatagatatg
gtcctggaggagaaatga

DBGET integrated database retrieval system