KEGG   Methanosaeta thermophila: Mthe_1647Help
Entry
Mthe_1647         CDS       T00417                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_1647
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1647
   00020 Citrate cycle (TCA cycle)
    Mthe_1647
   00620 Pyruvate metabolism
    Mthe_1647
   00640 Propanoate metabolism
    Mthe_1647
   00650 Butanoate metabolism
    Mthe_1647
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1647
   00680 Methane metabolism
    Mthe_1647
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mthe_1647
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mthe_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1791749..1792006)
Genome map
AA seq 85 aa AA seqDB search
MKITVAALTEPGSTIVNKTGAWRTFVPVVNHKRCIKCSLCEIYCPEGCIHQIDGLFVPDL
DYCKGCGVCAHECPRKAIDMVLEEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaagataacagttgcagctctgacggagccaggcagcactattgtaaacaagaccgga
gcgtggcgcacattcgttccggttgtgaatcacaagagatgcataaagtgcagcctctgc
gagatttactgccctgaggggtgtatacatcagatcgacggactgttcgttccagatctg
gattactgcaagggatgcggggtctgcgctcatgagtgccccagaaaggcgatagatatg
gtcctggaggagaaatga

DBGET integrated database retrieval system