KEGG   Methanosaeta thermophila: Mthe_1648Help
Entry
Mthe_1648         CDS       T00417                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_1648
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1648
   00020 Citrate cycle (TCA cycle)
    Mthe_1648
   00620 Pyruvate metabolism
    Mthe_1648
   00640 Propanoate metabolism
    Mthe_1648
   00650 Butanoate metabolism
    Mthe_1648
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1648
   00680 Methane metabolism
    Mthe_1648
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mthe_1648
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mthe_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1792003..1792542)
Genome map
AA seq 179 aa AA seqDB search
MKEIRFHGRGGQGAVTAAEMIAIAAFEDGRFSQAFPAFGVERRGAPVMAFARINDKPIRM
RSQVYEPDYVIVQDVTLLDVVDVTGGLKSDGKIIINTDRDASALKLNTEAEVVTIDATRI
AIDTLGRPIVNTTMLGAFCGATKEVKLESLEKSILTRFSGSLGEKNIQAVRTAYERVVR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggagataaggttccacgggcgaggagggcagggagcggtcaccgctgctgagatg
atcgccatcgcggccttcgaggacggcaggttctcccaggcgtttcccgccttcggggtg
gagcgcagaggcgcccctgtgatggctttcgccaggattaatgacaagccaatacgcatg
agaagccaggtgtacgagccggattacgtcatcgtgcaggacgtcacgctgctcgatgtc
gtcgatgtgaccggcggtttgaagtcggatggaaaaataataataaatactgacagagat
gcctctgcgctcaaactgaatacagaggctgaggtggtgacgatagacgcgactcgaatc
gccatcgatactcttgggaggccgatagtcaacacaacaatgctcggcgcattctgcggg
gcgactaaagaggtgaaactggagagcctggagaagtcgatcctcaccagattctcgggc
agtttgggtgagaagaacattcaagccgtaagaacagcctatgagagggttgtcagatga

DBGET integrated database retrieval system