KEGG   Methanosaeta thermophila: Mthe_1702Help
Entry
Mthe_1702         CDS       T00417                                 

Definition
putative rRNA pseudouridine synthase (EC:4.2.1.70)
Orthology
K11131  
H/ACA ribonucleoprotein complex subunit 4 [EC:5.4.99.-]
Organism
mtp  Methanosaeta thermophila
Brite
Enzymes [BR:mtp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.-  
     Mthe_1702
DNA replication proteins [BR:mtp03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (Animals)
    Dyskerin complex
     Mthe_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1858558..1859523)
Genome map
AA seq 321 aa AA seqDB search
MRREGSTNSSYGCFPDRRPLQEHLRLGAINLDKPSGPTSHEVVAWVKRILGLEKAGHSGT
LDPRVTGILPVLTGDATRVVEFLLTAGKEYVCLMRTHEQVPRKKILEVCEEFSGEIYQRP
PLKSSVARNLRTRKIYYIDVLEIEGQRVLMKVGCEAGTYIRKLCYDMGLALGCGANMEEL
RRTKAGPFAEDETLVTLHNLKDAYEIWRESGDESALRRAVLPVERALRHLPGLVISDNAV
DAICHGAPLAAPGLLSLETDINKGDFVVIYTLKGEAVAIGRAKLSSDEMMVAKSGIVAST
ERVIMDPGVYPRRWKHSAEVV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgtgagggctccacgaattcatcttatggctgctttccagatagacgacctctc
caggagcatctaaggctcggcgcgataaatctcgacaagccctcggggccgacgagccac
gaggtcgtcgcctgggtcaagaggattctggggctggagaaggcagggcacagtggcacc
ctggatccgagggtgacaggcatactgccggtgctcaccggtgatgcgacacgggttgtg
gagtttttgctcacagccggcaaggagtacgtctgtctgatgaggactcatgagcaggtc
cccaggaaaaagatcctggaagtctgtgaggagttctcgggtgagatataccagaggccc
ccactgaagtcgagcgtcgccagaaatctgcgaaccaggaagatatactacatcgatgtc
ctggagatcgagggccagagggtgctgatgaaggtcggatgcgaggccggaacgtacatc
agaaagctatgctacgacatggggctcgcgctgggatgcggcgcaaacatggaggagctg
cgaaggacaaaggccgggccattcgcggaggacgagactctcgtcacgctgcacaatctc
aaagatgcgtacgagatctggcgcgagagcggggatgagagcgctctgaggagagctgtt
ctgccggttgagagggccctcaggcatcttcccggtctcgtaatatctgataatgcagtt
gatgcgatctgccacggcgcacccctggcggctccgggtctgttgagcctggaaacagat
ataaacaagggtgatttcgttgttatctacaccctcaagggtgaggcggttgcaatcggc
agggcgaagctctcgagcgatgagatgatggtggcgaagagcggaatagtcgcgtcgacc
gaaagggtgataatggatcccggtgtttacccaagacgctggaagcacagtgccgaggtc
gtctag

DBGET integrated database retrieval system