KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_1137Help
Entry
HKBS1_1137        CDS       T03154                                 

Gene name
fadA3
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00071  Fatty acid degradation
mtq00072  Synthesis and degradation of ketone bodies
mtq00280  Valine, leucine and isoleucine degradation
mtq00310  Lysine degradation
mtq00362  Benzoate degradation
mtq00380  Tryptophan metabolism
mtq00620  Pyruvate metabolism
mtq00630  Glyoxylate and dicarboxylate metabolism
mtq00640  Propanoate metabolism
mtq00650  Butanoate metabolism
mtq00900  Terpenoid backbone biosynthesis
mtq01100  Metabolic pathways
mtq01110  Biosynthesis of secondary metabolites
mtq01120  Microbial metabolism in diverse environments
mtq01130  Biosynthesis of antibiotics
mtq01200  Carbon metabolism
mtq01212  Fatty acid metabolism
mtq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBS1_1137 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    HKBS1_1137 (fadA3)
   00640 Propanoate metabolism
    HKBS1_1137 (fadA3)
   00650 Butanoate metabolism
    HKBS1_1137 (fadA3)
  Lipid metabolism
   00071 Fatty acid degradation
    HKBS1_1137 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    HKBS1_1137 (fadA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBS1_1137 (fadA3)
   00310 Lysine degradation
    HKBS1_1137 (fadA3)
   00380 Tryptophan metabolism
    HKBS1_1137 (fadA3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBS1_1137 (fadA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBS1_1137 (fadA3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HKBS1_1137 (fadA3)
Enzymes [BR:mtq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBS1_1137 (fadA3)
Exosome [BR:mtq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBS1_1137 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ41783
Position
complement(1196851..1198068)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAMKGSLVGMRPDDLAVQMVRAALDKVPALNPHQIDDLMMGCGLP
GGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SRFAKGNSDSWPDTKNPLFDGAQERSAAAAAGADEWHDPRTDQKLPDIYIAMGQTAENVA
IMTGISREEQDRWGVRSQNRAEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKV
SELKPAFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEASKKALERAGMAITDIDLVEINEAFAVQVLGSARELGIDEDKLNISGGAIALGH
PFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctgtcatcgtctcgactgcccgctcgccgattggccgggccatgaaagga
tcgctggtcggcatgcggcccgacgacctggccgtccagatggtgcgcgccgcgctcgac
aaggttccggcactgaacccccatcagatcgacgacctcatgatgggctgtggcctgcca
ggcggtgagtccggtttcaacatcgcccgtgtcgtcgccgtcgcgctcggctatgacttc
ctgccgggcaccacggtcaaccggtactgttcgtcgtcgctgcagaccacccggatggcc
ttccacgcgatcaaggccggtgagggcgacgcgttcatctccgcgggcgtggaaaccgtc
tcccggttcgccaagggaaactccgactcctggccggacaccaagaacccgctgttcgac
ggggctcaggaacgttcggccgcggcagccgccggcgccgacgaatggcacgatccccgc
accgatcagaagctgccggacatctatattgcgatgggccagaccgcggaaaacgtcgcc
atcatgaccggcatcagccgcgaagaacaggaccgctggggcgtgcgcagccagaaccgg
gccgaagaggcgatcaagaacgggttcttcgaacgagaaatcacgccggtcacccttccg
gacggcaccacggtcagcaccgacgacggcccgcgaccgggtaccacctacgaaaaggtc
agcgagctcaagccggctttccggccgaatggcaccgtgaccgcggggaatgcctgtccg
ctcaacgacggggccgccgcggtggtgatcaccagcgacaccaaggccaaggaattaggc
ttgacaccgctggcgcgcattgtgtccaccggggtcagcgggctgtccccggagatcatg
ggcttagggccgatcgaggcgtccaagaaggcgctggaaagagccgggatggcgatcacc
gacatcgacctggtcgagatcaacgaggccttcgcggtgcaggtcctgggctcggcgcgc
gagctgggcatcgacgaggacaagctcaacatctcaggtggcgcgatcgccctaggtcac
ccgttcggtatgacgggcgcgcgcatcaccaccacgctgttgaacaacctgcagacctac
gacaagacgttcggtctggaaaccatgtgtgtcggtggcggccagggcatggcgatggtg
atcgagcgcctcgcgtga

DBGET integrated database retrieval system