KEGG   Medicago truncatula (barrel medic): MTR_074s0001Help
Entry
MTR_074s0001      CDS       T01716                                 

Definition
Cell division cycle protein-like protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mtr04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 746 aa AA seqDB search
MSASDHVKATTQWPLNSILPQNCPVNVMLPRDNIGTKMPQSRYLFAISCFHMNLLGEAEA
ALCPANEPGAEFSRMLLQSCEAPAENEVPNGAPGHYLLGQVYRYTDRKKRAIDHFKQALS
KDPLMWAAYEELCILGDAEEATTVFGEAASFCMQKQYLNCSTSPNLSAEDCNVVATNSVS
EDVSPRKLRLMQGLKDIAANPHGSSIIGGAASQLISSGSSNMSFYNTPSPMATQLSSVAP
PPLCRNVMPNGPNLSTLNSDNSPKSTVNSTIQAPIQAPRRKFVGEGKLRKISGRLFSDSP
RRSSRLSNEASVSSNANATMLSGNGTSNSYKGGSKLGPMTFRTMTVRKGQSWANENMDGG
IHNDAVDVSRLNISSTTSCSSAAVEAKAYEQDATTLQVSGQATSESKVITGASEILTILR
VLGEGYRLACLYRCKEALDTYLKLPQRHYNTGWVLSQVGKAHYELVDNLEADRVFSLARQ
IAPYSLEGMDIYSTVLYHLKEDMKLSYLAQELISTDRLAPQSWCAMGNCYSLQKDHETAL
KNFQRAVQLNPRFAYAQTLCGHEYVAQEDFENGIKSYQRALMVDPRHYNAWYGLGMLYLH
QEKFEFSEHHFRMAFRINPKSSVILSYLGTALHFLKRSEEGLAVMEKAILADKKNLLPMY
QKANILMSLERFDEALEVLDELKEYAPFESSVFALMGNIYKRRNMHERAMFHYGIALDLK
PSATDAATIKAAIEKLYLPDELEDNL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctctgaccatgtgaaagcaaccacacaatggcctctgaatagcattttgcca
caaaattgccctgtcaatgtcatgctgcctcgagacaacattggaacaaaaatgcctcaa
tctcgatacttgtttgcaatatcatgttttcatatgaatcttcttggcgaagctgaagca
gcattgtgccctgctaatgagccgggtgcagagttttcaaggatgctgttgcagagttgc
gaagctcctgcagagaatgaagttccaaatggtgcacctggtcattatctattgggacag
gtttacaggtacactgacagaaagaaaagggccatagatcattttaagcaggcactatca
aaggatcctctaatgtgggctgcatacgaggagttgtgtatattaggtgatgctgaagaa
gctactacagtttttggtgaagcagcttctttttgcatgcaaaagcaatatctgaattgc
tcaacctctccgaatttgtcagctgaagattgtaatgtagttgcgaccaacagtgtctct
gaagacgtgagtccaaggaaactaagactcatgcaaggtcttaaggatattgctgcaaac
cctcacggatcatctataattggaggagctgctagtcaacttatcagtagtggttcatct
aacatgtcattttataacaccccgtctccaatggccacacagttgtcatctgttgctcca
ccccctttgtgtaggaatgtaatgccaaatggcccaaatctgagcacacttaattctgac
aattctcctaagtcgacagttaactctactattcaagctcctattcaagcccctcgaagg
aagtttgtgggtgaaggaaagttacgaaagatttcgggtaggttattttctgattctcct
cgacgtagttcaagactctctaatgaagcaagtgtaagttcaaatgctaatgcaacaatg
ttgtctggaaacggaactagtaactcttataagggagggtcaaagcttggccctatgaca
tttcgtaccatgacagttcgaaagggacaatcatgggccaatgaaaacatggatggaggg
attcataatgatgctgtggatgttagtcgtttaaatatttcatcaacaacttcttgttca
tctgctgccgttgaagctaaagcgtatgaacaagatgcaacaactcttcaagttagtggg
caagcaacaagtgagtctaaagtcatcactggtgcatccgaaatattgaccattctaaga
gttcttggtgaaggctataggcttgcctgcttgtataggtgcaaggaagcactggatacc
tatctgaaacttccacagaggcattacaatacaggatgggttctttctcaggttgggaag
gcacactatgagttagttgataatttagaagctgatcgggtctttagtcttgctcgtcaa
attgcaccttatagtttggaagggatggatatatactcaaccgtcctttatcatttaaag
gaagatatgaagctaagctacctggcccaggaactgatttcaactgatcggttagcccct
caatcctggtgtgccatgggaaattgctacagcctgcaaaaagatcatgaaactgcactg
aaaaattttcaacgagcagttcaactgaatccaagatttgcatatgcacaaaccctttgt
gggcatgagtatgttgcacaagaagattttgaaaatgggattaagagctatcagagagca
ctcatggtcgacccaaggcactataacgcatggtatggactcggaatgttatatctccac
caagagaaatttgagttctctgaacatcatttccgtatggctttccgaatcaacccaaaa
tcttctgtgatattgtcataccttggaactgctttgcattttttgaagagaagtgaggaa
ggtttggccgtgatggagaaagctattttagcagataagaaaaatctactcccgatgtat
caaaaggccaacattctaatgagcctggaaaggtttgacgaggctttagaagtcctagac
gagcttaaagagtacgctcccttcgaaagtagtgtctttgctttgatgggcaatatctat
aaaaggcgtaacatgcatgagagagccatgtttcattatggtattgctttggatttgaaa
ccatctgcaacggatgctgccaccattaaggctgccattgagaaattgtatttgcctgat
gagctggaagacaacttgtag

DBGET integrated database retrieval system