KEGG   Medicago truncatula (barrel medic): MTR_077s0031Help
Entry
MTR_077s0031      CDS       T01716                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_077s0031
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTR_077s0031
   00630 Glyoxylate and dicarboxylate metabolism
    MTR_077s0031
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MTR_077s0031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 567 aa AA seqDB search
MDLGTYGFPTPTAKNIISNYDAPEGVEVRGRYDAEFAKILTKDALKFVADLQREFRNHIK
YALECRKEAKRRYNEGALPGFDPATRYIREGDWICAPVPPAVSDRKVEITGPVERKMIIN
ALNSGAKVFMADFEDALSPSWENLMKGQVNLKDAVAGTITFHDKGRNKVYKLNDEIAKLF
VRPRGWHLPEAHILIDGEPATGCLVDFGLYFYHNHSTFRRSQGGGFGPFFYLPKMEHSRE
AKIWNKVFEKAEKMTGIERGSIRATVLIETLPAVFQMDEILYELRDHSVGLNCGRWDYIF
SYVKTFHAHPDRLLPDRVQVGMSQHFMKSYSDLLIRTCHRRGVHAMGGMAAQIPIRDDPV
ANEAALELVRKDKLREVKAGHDGTWAAHPGLIPSCMEIFNNNMGNAPNQITTMKREDAAK
LTEEDLLQIPRGVRTMEGLRLNTRVGIQYVAAWLTGSGSVPLYNLMEDAATAEISRVQNW
QWLKYGVELDGDGLGVKVSKELFGRVVEEEMDRIEKEVGKDKFKKGMYKDACKIFTRQCT
SPTLDDFLTLDAYNYIVVVHPVELSKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggacctcggaacctatggctttccgacaccaacagccaagaatatcatctctaactac
gatgcaccagaaggcgtcgaagttaggggaagatatgatgcagagtttgcaaaaattcta
accaaagatgctttgaaatttgttgctgatttgcaacgtgagttcagaaaccatataaag
tatgcactagagtgtagaaaagaagcaaagagaaggtacaatgaaggagctctaccaggt
tttgatccagcaactagatacataagagaaggagattggatctgtgcacctgttccacca
gctgtttctgataggaaagttgagattactggccctgttgagagaaagatgatcatcaat
gctcttaactctggagctaaagtctttatggctgattttgaggatgcactttctccaagc
tgggagaatcttatgaaaggtcaagtgaacttgaaggatgctgtggctgggaccataaca
ttccatgacaaaggtagaaacaaagtttacaagctgaatgatgagatagcaaagcttttt
gtgcgaccaagaggttggcatttaccggaagctcatattctgattgatggtgaacctgca
accggttgtcttgttgattttggtctctacttctaccacaatcactcaacttttcggcgt
tctcaaggtggtggttttggccctttcttctaccttcccaaaatggagcattcaagggaa
gcaaagatatggaacaaagtattcgagaaggcagagaagatgacaggcattgaaagagga
agcataagagccacagttttgattgaaacacttcctgcagtgtttcaaatggatgaaatt
ctgtatgagctcagagatcactctgttggtctcaactgtggccgttgggattacattttc
agttatgttaagaccttccatgctcatccggataggttgctaccggatcgggtccaagtt
ggcatgagtcaacacttcatgaagagctactcagaccttctcattaggacatgtcatagg
cgcggtgtacatgccatgggaggaatggcagctcaaattccaataagagatgatccggtg
gcaaatgaagccgcgctagaattggttagaaaagacaaactaagagaagtgaaggcaggg
catgatggaacatgggcagcacaccctggtctaataccatcctgtatggaaattttcaac
aacaacatgggaaatgctcctaatcaaataaccacaatgaaacgcgaagacgctgcaaaa
ctaaccgaagaagaccttctgcagatacctagaggagtccgaacgatggaaggtttaagg
ttgaatacaagggttggaattcagtatgtagcagcatggctcactggatcaggttctgtg
ccactttacaatctcatggaagatgctgcgactgccgagattagtagggttcagaattgg
cagtggcttaagtatggagttgaacttgatggtgatggacttggagtgaaagtgagtaaa
gaactatttggtagagttgttgaagaagagatggataggattgaaaaagaggttggaaaa
gataagttcaagaagggaatgtataaggatgcttgcaagattttcactaggcaatgcact
tcaccaacacttgatgattttctcactcttgatgcctataattatattgttgtagttcac
cctgtggaactgtcaaagctttga

DBGET integrated database retrieval system