KEGG   Medicago truncatula (barrel medic): MTR_091s0008Help
Entry
MTR_091s0008      CDS       T01716                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_091s0008
   01230 Biosynthesis of amino acids
    MTR_091s0008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_091s0008
   00030 Pentose phosphate pathway
    MTR_091s0008
   00051 Fructose and mannose metabolism
    MTR_091s0008
   00052 Galactose metabolism
    MTR_091s0008
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MTR_091s0008
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MTR_091s0008
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MTR_091s0008
Messenger RNA biogenesis [BR:mtr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MTR_091s0008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MDGSSSSSSSSSLELEDVTNLFEPIKLKDLPHLNHYISNLKTFPNPLDQNPYFHTPQLQH
FYITNNNLVFSHSTRFAYRTAGPRNNVFFNPSDVRAAIVTCGGLCPGLNTVIRELVVGLW
DLYGVRQIFGITAGYRGFYSSSTQPVQLNPNIVHHWHTKGGTFLQTSRGGFDLCKIVDAI
QNQAFNQVYIIGGDGTMRGAVKIFNEIKQRKLNVAVVGIPKTVDNDVGIIDRSFGFQTAV
EMAQQAISAAHVEAESAVNGIGLVKLMGRSTGHIVLHSTLSSRDVDCCLIPELDFYLEGK
GGLFEFLDQRLKENGHAVLVVAEGAGQDIIPRTESHKEERDESGNPVFLDVGVWLKSELN
KWWDRDHPGELFTVKYIDPTYMIRAVHANATDNLYCTLLAHSAIHGVMAGYTGFVAAPIN
GNYAYIPLEDVACAKNPVNTKDHNWSWVRSVTNQPDFLKS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggatggttcttcttcttcttcttcttcttcttctttagaactcgaagatgtaacaaac
ttattcgaacccattaagctaaaagatcttcctcatctcaaccactacatctcaaacctc
aaaaccttcccaaatccacttgatcaaaatccttacttccacaccccccaactccaacac
ttctacatcactaataacaacctcgttttctctcactccacacgcttcgcttatcgcacc
gctggtcctcgcaacaacgtcttcttcaacccttctgatgtaagagctgctattgtaaca
tgcggtggtctctgtcctggacttaacaccgttattagagagcttgttgttggtctttgg
gatctctacggggttcgacagatttttggtatcactgctggttacagaggcttttattct
tcttctactcaaccggttcagcttaaccctaatattgttcaccattggcataccaaaggt
ggtacttttcttcagacttctagaggcggttttgatctatgcaagatcgttgatgccatc
caaaatcaagccttcaatcaggtgtacattataggtggagatgggactatgcgaggggct
gtgaagatattcaatgaaataaagcaacgtaaactgaatgttgcagttgttggaattcct
aaaacagtggataatgatgtgggaataattgacagatcttttggatttcaaacagcagtt
gaaatggctcagcaagcaatcagtgctgctcatgtggaggccgagagtgcagttaacggt
ataggccttgtgaagttgatgggtcgaagcacaggtcacattgttcttcattcaacactc
agcagccgtgacgttgattgctgcctaatccctgaactagatttttacttggaaggaaaa
ggagggctctttgagtttcttgaccaacgactgaaagaaaatggtcatgcagtgcttgta
gttgctgagggtgctggccaggatataataccaagaacagagtcacataaggaagagcga
gatgaatctggtaacccagttttcttagatgttggagtgtggttaaagtcagagctgaac
aagtggtgggacagggaccatcctggtgagctatttacagtcaagtatatagatcctaca
tacatgattcgcgcagtccatgcaaatgctactgataatttgtattgtacactcttggcg
cactctgcaattcatggtgttatggctggatatactggatttgttgctgctcctattaat
ggcaattatgcatacattccacttgaagatgtagcatgtgcaaaaaacccagttaataca
aaagatcataattggtcatgggtgagatcagtcaccaatcagcctgattttctaaagagc
tag

DBGET integrated database retrieval system