KEGG   Medicago truncatula (barrel medic): MTR_119s0014Help
Entry
MTR_119s0014      CDS       T01716                                 

Definition
DNA polymerase delta subunit 4 family protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MTR_119s0014
   00240 Pyrimidine metabolism
    MTR_119s0014
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MTR_119s0014
   03410 Base excision repair
    MTR_119s0014
   03420 Nucleotide excision repair
    MTR_119s0014
   03430 Mismatch repair
    MTR_119s0014
   03440 Homologous recombination
    MTR_119s0014
DNA repair and recombination proteins [BR:mtr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      MTR_119s0014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 95 aa AA seqDB search
MSSSGNVKEKESKNMSSSSSVTGNVNGGVTDEQNNSESVLRQFDLNMDYGPSIGLTRLER
WERAKKWDMNPPQEIKELILKSGNDQQEGLWNKRV
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatctggaaatgtgaaagagaaagagagtaagaatatgtcttcttcttcatca
gttactgggaatgtgaatggtggggttacagatgaacaaaacaacagcgagtcggtgctg
cgacaattcgacctgaacatggattatgggcctagcattgggctgacgaggctggaacga
tgggagcgtgcaaagaagtgggatatgaatcctccgcaggaaattaaggaactgatcttg
aagagtggtaatgatcagcaagaaggcctatggaacaaacgcgtttag

DBGET integrated database retrieval system