KEGG   Medicago truncatula (barrel medic): MTR_124s0002Help
Entry
MTR_124s0002      CDS       T01716                                 

Definition
Dihydroflavonol reductase
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    MTR_124s0002
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MTR_124s0002
    1.1.1.234  flavanone 4-reductase
     MTR_124s0002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MGSVSETVCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSL
WKADLGEEGSFDEAIKGCTGVFHVATPMDFESKDPENEMIKPTIKGVLDIMKACLKAKTV
RRFIFTSSAGTLNVTEDQKPLWDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKE
HNMDFITIIPPLVVGPFLIPTMPPSLITALSPITGNEAHYSIIKQGQFVHLDDLCEAHIF
LFEHMEVEGRYLCSACEANIHDIAKLINTKYPEYNIPTKFNNIPDELELVRFSSKKIKDL
GFEFKYSLEDMYTEAIDTCIEKGLLPKFVKSTNK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagtctcagaaacagtttgcgtcacaggggcttcaggtttcatcgggtcgtgg
cttgttatgagacttatggagcgcggctacacagttcgagccaccgtgcgcgacccagat
aacatgaagaaggtgaagcatttgttggaactgccaggtgcaaatagcaaactatctctt
tggaaggctgaccttggggaagagggtagttttgatgaagctattaaagggtgtacagga
gtttttcatgttgctactcctatggattttgagtccaaggaccctgagaatgaaatgatc
aagcctaccataaaaggggtgctagacatcatgaaagcatgcctcaaggccaaaactgtc
cgtagatttattttcacatcatcggccggaaccctaaacgttactgaagatcaaaagccc
ttgtgggatgaaagctgttggagtgatgttgagttttgtaggagagtgaagatgactggc
tggatgtattttgtttcaaagacacttgcggagcaagaagcatggaaatttgccaaagag
cacaacatggatttcatcacaatcatcccacctcttgttgttggtccttttcttattcct
accatgccacctagcctaatcactgccctttctcctatcactggaaatgaagctcattat
tcgattataaagcaaggccaattcgtccacttggatgatctttgtgaagctcacatattc
ttgtttgagcatatggaagtagaagggaggtatctatgtagtgcatgtgaagctaatatt
catgacattgcaaaattaattaatacaaaatatccagagtacaatatccccacaaagttc
aataatattccagatgaattggagcttgtgagattttcatcaaagaagatcaaagacttg
ggattcgagtttaaatacagcttggaggatatgtacactgaagcaattgatacatgcata
gaaaaagggcttcttcctaaatttgttaaaagcaccaataagtaa

DBGET integrated database retrieval system