KEGG   Medicago truncatula (barrel medic): MTR_130s0014Help
Entry
MTR_130s0014      CDS       T01716                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MTR_130s0014
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MTR_130s0014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 409 aa AA seqDB search
MNQTTLSSPHHYHLTNQPNTNTKNPTQFLRFRQNDKQNLPVLRFAVNPSSQVPPVVVVGS
ANADIYVEIDRLPKEGETISAKSGQTLAGGKGANQACCGAKLSHPTYFLGQVGNDAHGNL
VADALRDGGVRLDYLAVVSSAPTGHAVVMLQSSGQNSIVIVGGANVSCWPQTLPPKQLEV
VSSAGIVLLQREIPDFVNVQVAKAAKSAGVPVIFDAGGMDAPIPQELLDFVDIFSPNESE
LGRLTGLPTESFEEITQAAAKCHKLGVKQVLVKLGAKGSALFIDGEEPIQQPAIFAKTVI
DTTGAGDTFTAAFAVALVEGKSKKECLRFVITNGIYRSIEHRAIVNSEKERMSIATFYTS
RHDGEMAPANSLITEETPARFKRIGLKEFLRNMFARKLDGKSFLDELRI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaacaactctttcatcaccacaccattaccaccttacaaatcaaccaaacaca
aacaccaaaaacccaactcaattccttcgattccgccaaaatgacaaacaaaacctccca
gtgttgcgtttcgctgtaaacccatcatcacaggttccaccggtcgttgttgtcggatcc
gccaatgcagacatttatgtagagatcgaccgcctcccaaaagaaggcgaaacaatctcc
gcaaaaagtgggcagacgttagccggtgggaaaggtgctaatcaggcttgctgtggtgct
aaattatctcatccgacttacttcctcggtcaggttggaaacgatgctcatggaaacctc
gtcgccgatgcacttcgagacggtggtgttcgcctcgattatctcgcagttgtgtcttct
gctccgactgggcatgcagttgttatgcttcagtctagtggccagaattctattgttatt
gttggtggtgctaatgtgagttgttggcctcagactctgccacctaagcagttggaggtt
gtttcgtccgctgggattgttctgttgcagagggagatccctgattttgttaatgttcaa
gtggcaaaggctgcaaagagtgctggtgtgccagtaatatttgatgccgggggaatggat
gcacctattccacaagaattactagatttcgttgatatttttagtcccaatgaaagtgaa
cttggtcgccttacaggacttccgactgaaagttttgaagagattacacaggctgctgcc
aaatgccataaattgggtgttaagcaagttctcgtgaaacttggtgccaaaggatctgcc
cttttcatagatggagaagaaccaattcagcaacctgccatttttgctaaaacagtcatt
gatacaactggagctggtgatactttcactgctgcttttgctgtggccttggtggagggc
aagtccaaaaaggaatgcctcagatttgttataactaacggaatatatcgaagtatcgag
catcgagcaattgtaaactctgaaaaagaaagaatgtcaattgcaacattctatacttca
agacatgatggagagatggctcctgcaaatagcttgatcactgaagaaacaccagcacgt
ttcaaaagaattggactaaaagaattcttgaggaatatgtttgctcgtaaacttgatggc
aagtctttcctagatgaactgaggatatag

DBGET integrated database retrieval system