KEGG   Medicago truncatula (barrel medic): MTR_145s0008Help
Entry
MTR_145s0008      CDS       T01716                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_145s0008
   01230 Biosynthesis of amino acids
    MTR_145s0008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_145s0008
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTR_145s0008
Enzymes [BR:mtr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MTR_145s0008
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MTR_145s0008
  Exosomal proteins of melanoma cells
   MTR_145s0008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 343 aa AA seqDB search
MAAEVCHHAIGSLQSHSHLGNLNHHQNIRSGVLRLATKDFISNGLSKGISSCFGQRNCIV
IRSSASHSQTSVVDPVLSPSKSNTGDTSKKSNEAALILIRHGESLWNEKNLFTGCVDVPL
SKKGIDEAIEAGKRISSIPVDLIFTSALIRAQMTAMLAMTQHRRRKVPIVMHNESEQAKA
WSQVFSEDTKKQSIPVIAAWQLNERMYGELQGLNKQETADRYGKEQVHEWRRSYDIPPPN
GESLEMCAERAVAYFRDQIEPQLLSGKNVMIAAHGNSLRSIIMYLDKLTSQEVISLELST
GIPMLYIFKEGRFIRRGSPIKPTEAGVYAYTKVSFGSLQAEVG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgaagtatgtcaccatgctattggctctttgcaatctcattctcatcttggt
aatttgaatcatcaccaaaatatcagaagcggtgtattaagattggcgacaaaggacttt
atcagtaatggcttgtcaaagggaataagtagctgctttggccagagaaattgtattgtt
attcgatcttcggcttcccattcccagacatcggttgttgatccagtgttgtccccttca
aaaagcaacaccggtgacacttccaagaaatcaaatgaagctgctttgatccttattcga
cacggtgagtcgttgtggaatgagaagaatttgttcacaggttgtgttgatgtaccactt
agcaagaagggtatagacgaggcaattgaagctggaaaaagaattagtagcattccagtt
gatctcatatttacatctgctttgattcgtgcacaaatgacagccatgcttgccatgacc
cagcaccgccgtagaaaggtgcctatcgttatgcacaacgagagtgaacaagcaaaggca
tggagtcaagtttttagtgaagatacaaaaaagcagtccattccagtcatagcagcttgg
caactaaatgaaagaatgtatggagaactacagggtctcaataagcaagaaacagcagac
agatatgggaaagaacaagtccatgagtggcgccgaagctatgacatacctcctcccaat
ggtgaaagtctggaaatgtgtgctgaaagagcagttgcctatttcagagaccaaattgaa
ccccaacttttatctggaaagaatgttatgattgccgcacacgggaattcattgagatcc
attatcatgtatctcgacaaattaacttcccaggaggttattagtttagaactgtcaact
ggaattccaatgctttacattttcaaagaaggaagattcattaggagggggagtcccata
aaaccaactgaagctggagtttacgcctataccaaggtatcgtttggctctttacaggca
gaagttggatga

DBGET integrated database retrieval system