KEGG   Medicago truncatula (barrel medic): MTR_146s0011Help
Entry
MTR_146s0011      CDS       T01716                                 

Definition
Acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MTR_146s0011
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTR_146s0011
   00640 Propanoate metabolism
    MTR_146s0011
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MTR_146s0011
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    MTR_146s0011
Enzymes [BR:mtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MTR_146s0011
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MTR_146s0011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2256 aa AA seqDB search
MASAGRGNGYLNGVLPSRHPATTTEIDEYCNALGGNKPIHSILIANNGMAAVKFIRSVRS
WAYETFGTEKAILLVAMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLILEIAEI
THVDAVWPGWGHASENPELPDALKAKGIVFLGPPAISMAALGDKIGSSLIAQAAEVPTLP
WSGSHVKIPPESDLITIPDEIYRAACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKV
HNDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLICDQHGNVAALHSRDCSVQRRH
QKIIEEGPITVAPPETVKELEQAARRLAKSVNYVGAATVEYLYSMETGEYYFLELNPRLQ
VEHPVTEWIAEINLPAAQVAVGMGIPLWQIPEIRRFYGMEHGGGNDGWRKTSLLATPFDF
DKAQSTKPKGHCVAVRVTSEDPDDGFKPTGGKVQELSFKSKPNVWAYFSVKSGGGIHEFS
DSQFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLNASDYRDNKIHTGWL
DSRIAMRVRAERPPWYLSVVGGALYKASASSAALVSDYVGYLEKGQIPPKHISLVHSQVS
LSIEGSKYTIDMIRGGPGSYKLKLNQSEIEAEIHTLRDGGLLMQLDGNSHVIYAEEEAAG
TRLLIDGRTCLLQNDHDPSKLIGETPCKLLRYLVADDSHIDADTPYAEVEVMKMCMPLLS
PASGIIHFRMAEGQAMQAGELIAKLDLDDPSAVRKAEPFTGSFPILGPPTAISGKVHQKC
AASLNAARMILAGYEHNIDEVVQSLLNCLDSPELPFLQWQECFAVLATRLPKDLRNELEA
KYKEFEIISSSQTIDFPAKLLKAIFEAHLSSCPENEKGALERLVEPLTSLVKSYEGGRES
HAHKIVQSLFEEYLSVEELFSDNIQADVIERLRLQYKKDLLKIVDIVLSHQGVKSKNKLI
LRLMDKLVYPNPAAYRDQLIRFSQLNHIVYSELALKASQLLEQTKLSELRSSIARSLSEL
EMFTEDGENIDTPKRKSAINDRMEDLVSAPLAVEDALVGLFDHSDHTLQRRVVETYIRRL
YQPYLVKDSIRMQWHRSGLIATWEFLEEHVERKNGVEDKTLVEKHSEKKWGVMVVIKSLQ
FLPAIISAALREATNNFHDPLKSGSGDSSNHGNMMHIGLVGINNQMSLLQDSGDEDQAQE
RIDKLAKILREQEVGSIIHAAGVGDISCIIQRDEGRAPMRHSFHWSSEKLHYVEEPLLRH
LEPPLSIYLELDKLKCYENIRYTPSRDRQWHLYTVVDTKPQPIQRMFLRTLIRQPTTNEG
YSSYQRLDADTSRTQLAMSYTSRSIFRSLMGAMEELELNSHNTTIKSEHAHMYLYIIREQ
QIDDLVPYSKKINIETGQEETTVEAILEELAQEIHSSVGVRMHRLGVFVWEIKLWITACG
QANGAWRVIVNNVTGHTCTVHIYREMEDAITHKVVYSSVTLKGPLHGVPVNENYQPLGVI
DRKRLAARKNSTTYCYDFPLAFQTSLEQSWSIQQTGIQKANDKDLLKVTELKFSEKDGSW
GTSLVPAERVAGLNDVGMVAWLMEMCTPEFPSGRTILVVSNDVTFKAGSFGPREDAFFRA
VTDLACAKKIPLIYLAANSGARLGVAEEVKACFKVGWSEESKPEHGFQYVYLTPEDYARI
GSSVMAHELKLESGETRWVIDTIVGKEDGLGVENLSGSGAIAGAYSRAYKETFTLTYVTG
RTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNGVVH
LTVSDDLEGVSSILKWLSYVPSHVGGALPIVKPLDPPEREVEYLPENSCDPRAAISGTLD
VNGKWLGGIFDKDSFVETLEGWARTVVTGRAKLGGIPVGIVAVETQTVMQIIPADPGQLD
SHERVVPQAGQVWFPDSATKTAQAILDFNREELPLFIIANWRGFSGGQRDLFEGILQAGS
TIVENLRTYKQPIFVYIPMMGELRGGAWVVVDSRINSDHIEMYAERTAKGNVLEPEGMIE
IKFRTRELLECMRRLDQQLITLKEKLSEAKSNKDFGAYDSLQQQIRFREKQLLPLYTQIA
TKFAELHDTSLRMKAKGVIREVLDWRNSRSVFYRRLHRRIGEHSLINSVRDAAGDQLSYV
SAMNLLKEWYLNSDIVKGSEDAWLDDEAFFRWRDDTSYYEDKLKELRVQRLLLQLTNIGD
SALDLQALPQGLAALLSKLEASSRDKLTNELRKVLG
NT seq 6771 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgcagggcgtggaaatggatacttaaatggtgtgctaccgagtaggcaccct
gctactacaaccgaaatagatgaatactgcaatgcccttggaggaaacaagccgattcat
agcatattgattgcaaacaatggaatggcagcagtcaagtttatacgcagtgttaggagt
tgggcttacgagacgtttggcacagaaaaagctatcttgttggttgccatggctactcca
gaggatatgagaatcaatgcagaacatatcagaatagctgatcaatttgtggaagtacct
ggtgggacaaataacaataactatgccaatgtgcagcttattctagagattgctgagata
actcacgttgatgcggtgtggcctggttggggtcatgcatcagaaaatcctgagcttcca
gatgcattaaaagcaaaaggaattgtattccttggacctcctgctatatctatggcagca
ttgggagacaaaattggttcatcattgattgctcaagcagcagaagtgccaacccttcca
tggagtggttctcatgtgaaaattcctccagaaagcgacttgattactattcctgatgaa
atttaccgtgcagcatgtgtttatacaacagaagaagcaattgcaagttgtcaagtagta
ggttaccctgcaatgatcaaggcatcttggggtggtggtggtaaaggcataagaaaggtt
cataatgatgatgaggtaagggcattgttcaagcaagttcaaggtgaagtaccaggctca
cctatatttataatgaaagttgcttcccagagccgacatcttgaagtccaattgatttgt
gatcagcacggaaatgttgcagctttgcacagccgtgattgcagtgttcaaagaaggcat
caaaagattattgaagagggtcccattactgtagcacctccagaaacggtgaaagaactt
gaacaggcggctagaagattagctaaatctgtcaattatgttggggcagctaccgttgag
tatctttatagcatggaaactggcgagtactactttttagagttgaacccccgactacag
gttgagcatcctgttactgaatggatagctgagataaatctgccagcagcacaagttgca
gttgggatgggtatcccgctctggcaaattcctgagattaggcgtttctatgggatggaa
catggcgggggaaatgatggttggaggaaaacatcactgttagctaccccttttgatttt
gacaaagcacaatctacaaagccaaaaggtcattgtgtggctgtgcgagtgaccagcgag
gaccctgatgatggttttaagcctacaggaggaaaagtgcaggagctaagctttaaaagc
aagccaaatgtgtgggcttacttctctgttaagtccggaggaggaattcatgaattctca
gattctcaatttggacatgtgttcgcttttggagaatctagagctttagccattgcaaat
atggtactggggttgaaggaaattcaaattcgaggagaaattcgtaccaatgttgattac
acaattgatcttctgaatgcttcagactacagagacaacaaaattcacacaggatggcta
gacagtagaattgcaatgcgggttagagcagagaggcctccctggtatctgtctgttgtt
ggaggggcactctataaagcttctgctagcagtgcagctttggtttcagactatgttggc
tatcttgaaaaggggcaaatccctcctaagcacatttctcttgtccattctcaagtttct
ttgagcattgaaggaagcaaatacacgattgacatgatacgaggaggacctggaagttac
aaactgaaattaaatcaatcagagatagaagcggagatacacactttacgtgatgggggt
ttgcttatgcagttggatggaaacagtcatgtaatatatgcagaggaagaagcagctgga
actcggcttttaatcgatggaaggacttgcttgcttcagaatgatcacgatccatcaaag
ttaattggagagacaccgtgcaagcttctgagatatttggttgcggatgatagtcacatt
gatgcagacacaccatatgctgaagttgaggtcatgaaaatgtgcatgcctcttctttcc
cctgcttctgggattattcatttcagaatggctgaaggtcaagccatgcaggctggtgaa
cttatagcaaagcttgacctagatgatccttctgcagtaagaaaggcagaacccttcaca
gggagctttcctatcctgggccctcctactgcaatttcaggtaaagttcatcagaaatgt
gcagcaagcttaaacgctgcacggatgattcttgctggctatgagcacaatattgatgaa
gttgtgcaaagtttgctcaattgccttgacagccctgaactgcctttccttcaatggcaa
gagtgctttgcagttttggcgacccgtcttcccaaagatctaagaaatgagttggaagct
aaatataaggagttcgaaattatttcaagctcccaaactattgatttccctgccaaacta
ttgaaggcaatctttgaagctcatctttcctcctgtcctgaaaacgaaaaaggagcttta
gaaagactagttgaaccgctgacaagtcttgttaagtcttatgagggtggaagagagagc
catgctcataaaatcgttcaatctctatttgaagagtatctttcagttgaagaactattc
agcgataatatacaggctgatgtaattgaacggctccgtcttcaatacaagaaagatttg
ttgaagattgtagatatcgtgctctctcatcagggtgtcaagagcaaaaacaagctgata
ctgcgactaatggataaactggtttaccctaatcctgctgcctatagggatcagttaatc
cgattctcccaactcaaccatatagtttattctgagttggctcttaaggcaagtcaactg
ttggagcaaactaaactcagtgaacttcgatccagcattgctagaagtctttctgaacta
gaaatgtttacggaggatggtgaaaatattgatactccgaagaggaagagtgccattaat
gacagaatggaggaccttgtgagcgctcctttggctgttgaagatgcccttgttggttta
tttgatcacagtgatcacacccttcaaaggagagttgtggaaacttatatccgtaggctc
tatcagccatatcttgtcaaagatagcatcaggatgcagtggcacagatctggccttatt
gctacatgggaattcttagaagaacacgttgaacggaagaatggggttgaagacaaaaca
ctggtggagaaacatagtgagaagaaatggggagtgatggttgtaattaaatctcttcaa
tttttgccagcaattatcagtgctgcattaagagaagcaactaataactttcacgatcca
cttaaaagtggttctggtgactcaagtaaccatggtaatatgatgcatattggattagtg
ggcatcaacaaccaaatgagtttactacaagacagtggtgatgaggatcaggctcaagaa
agaattgataagttggccaaaatactcagagagcaggaagtagggtccataatacatgct
gcaggtgttggagatattagctgtatcatacagagggatgaagggcgtgctccaatgagg
cattcctttcattggtcatctgaaaagctacattatgtagaggaacctctgttgcgccat
cttgaacctcccctatccatttatcttgaactggacaagcttaagtgctatgagaatatt
cgctatacaccatcccgagatcgtcaatggcacctctacacggttgtggataccaagcca
caaccaattcaaagaatgtttcttcgaacacttatcagacagccaaccacaaatgaagga
tactcttcttatcaaagactggatgcagacacgtcccgtacccaattggctatgtcttat
acttcaaggagcatttttaggtccctaatgggcgcaatggaggagttggaacttaactca
cacaataccaccatcaaatctgaacatgctcatatgtacctctatatcatacgcgagcag
caaatagatgatcttgtgccttattccaagaaaattaacatagaaactggccaagaagaa
acaacagttgaggcaatcttggaagaactggcacaggaaatccattcctctgttggtgta
agaatgcacagattaggcgtttttgtgtgggaaatcaagctctggattacagcatgtgga
caggcaaatggtgcttggagggtcattgtaaacaatgtgactggtcatacatgcactgta
catatatatcgagagatggaggatgccatcactcataaagtggtctacagttcagtcact
ctaaagggaccactgcatggtgtaccggtgaatgaaaactatcaacctttgggagttatt
gaccgaaaacgtcttgcagcaagaaagaacagcaccacatactgctatgattttcccctt
gcatttcaaacatccttggaacagtcctggtcaattcagcagacaggaattcaaaaagcc
aacgataaggatctcctaaaagtaacagagcttaaattttccgagaaagatggtagttgg
ggtacttctcttgttcctgcagagcgtgttgctggactcaatgatgttggcatggtagcc
tggttgatggaaatgtgtacgcctgaattcccatctggaaggacaatattggttgtttca
aatgacgttaccttcaaggccggttcttttggcccaagagaggatgcattctttagagca
gtaaccgatcttgcctgtgcaaagaaaatacctttaatttacttggcagcaaattctggt
gcccgtttaggtgttgccgaggaagtcaaagcttgtttcaaagttggttggtctgaggaa
tctaaacccgagcatggttttcagtatgtatatttaacacctgaggattatgctcgaatc
ggatcatcagtgatggcacatgaattaaaacttgaaagtggagaaaccagatgggttata
gataccattgttggcaaagaagatggactgggagttgaaaacttgagtggtagtggggcc
attgctggtgcctattcaagggcatacaaggaaacctttacattgacatatgttaccggt
aggactgttggaattggtgcttatcttgctaggcttgggatgaggtgcatacagaggctt
gatcagcctataattcttaccgggttttcagcattaaacaaacttcttggtagggaggtg
tacagctctcacatgcaacttggtggaccgaaaatcatggcaacaaatggagtcgttcat
ctcactgtttcggacgaccttgaaggagtttcttctattttgaagtggcttagctacgtt
ccttctcatgtaggtggtgcacttcccattgtaaagccccttgatcccccagagagggaa
gtggagtatttaccggaaaattcatgcgatcctcgtgctgccatttctggaactctggat
gttaatggaaagtggctgggaggtatttttgacaaggacagctttgtggagacactagaa
ggatgggctaggacggttgttacaggaagggcaaagcttggaggaattccagtgggaatt
gttgcggtggaaacgcaaacagttatgcaaataatacctgctgatccaggccaacttgat
tctcacgagagggttgttcctcaagctgggcaagtgtggtttcctgattctgcgaccaag
acggcccaagcgatattggatttcaacagagaagagctcccacttttcattatcgcaaac
tggagaggcttttcaggtggacaaagggacctttttgaaggaattcttcaggctggttcg
actattgtggagaaccttaggacatacaagcagcccatatttgtatacatcccaatgatg
ggtgaactccgaggcggggcttgggttgttgtcgacagccgaatcaactcagaccacatt
gaaatgtatgccgaacgaacggctaaaggtaacgtccttgagccggaaggaatgattgag
atcaaatttagaacaagagaattgttggagtgtatgagaagacttgatcaacaattgatt
actttgaaggaaaaactttctgaagccaagagtaacaaagactttggtgcatatgattct
ctgcagcagcagattagattccgtgagaaacagcttttgcctttgtatactcagatagct
accaaatttgctgaactccatgatacttcattaagaatgaaagcaaagggtgtaatcagg
gaagttcttgattggcgtaactcgcgttctgtcttctatcggcgactgcacaggagaatc
ggtgagcactcactgatcaacagtgtgagagatgctgctggtgaccaattgtcatatgtt
tctgccatgaacttgctcaaagaatggtatctgaattctgatatcgtcaaaggcagtgaa
gatgcttggttggacgatgaagccttcttcagatggagggatgatacatcatattatgag
gataaactaaaggaattgcgcgtccagagactgttgcttcagttgacaaatattggcgac
tcggctctagatttacaagctctacctcaaggtcttgccgcccttttaagcaagttggaa
gcatcgagtcgcgataagttgaccaatgaacttcgcaaggtacttggttag

DBGET integrated database retrieval system