KEGG   Medicago truncatula (barrel medic): MTR_1g014040Help
Entry
MTR_1g014040      CDS       T01716                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase-like protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_1g014040
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTR_1g014040
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTR_1g014040
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTR_1g014040
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     MTR_1g014040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 409 aa AA seqDB search
MQRFKSLLPQTRFSSRTLSSHPRSFSALPNYAQRNDEEEDSQNQILVEGRAKSRAAILNR
PASLNALTTSMVARLKRLYDSWEENSDIGFVLMKGRGSAFCSGADVVRLYHSLNEGKAEE
AKEFFKTLYSFVYLQGTYLKPHVSILDGRTMGCGSGISLPGMFRVVTDKTIFSHPEAQIG
FHPDAGASYLLSRLPGYLGEYLALTGDKLNGVEMIACNLATHYSLNARLAWLEERLGKLV
TDDPSVVEASLSQYGDLVFPDRSSVLYKFDIIDRCFSHDTVEEIVEALEKEAVESSDEWC
LTTLRKIREASPLSLKVILRSIREGRFETLDQCLVREYRVSVQTISKNVSSDFVEGVRAR
MVDKDFAPKWDPPTLKDVSEDMVDHYFSPPLNELEPELVLPTALREPYM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcagagattcaaatctctgcttccacaaactcgcttctcatctcgcactctctcttct
catcctcgttctttctctgctctaccaaattacgctcaacgcaatgacgaagaagaagat
tcccaaaaccagattttggttgaaggaagagcgaaatcgcgtgcagccattctcaacagg
ccagcttctttgaacgcgcttactacttcaatggttgctaggttgaagaggctttacgat
tcatgggaagaaaactctgatattggttttgttctaatgaagggtagaggcagcgctttc
tgttctggtgcagatgttgttaggctgtatcactcgctcaatgaaggaaaggctgaagaa
gctaaagagtttttcaaaacattatattcatttgtatatcttcaagggacatatcttaaa
ccacatgtttctattttggatggaaggacaatgggctgtggatctgggatttctcttcca
ggaatgttccgtgtggtgactgataaaactattttttctcacccagaggctcaaataggc
ttccaccctgatgctggagcttcttaccttttgtctcgtctacctggctacttaggggaa
tacttggctcttacaggagataagcttaatggtgtagaaatgattgcttgcaaccttgct
acacattattcactaaatgcaaggcttgcttggcttgaagaacgccttggtaaattggtc
acagacgatccatctgttgtagaggcatctctatcacaatatggtgatcttgtttttccc
gacagaagtagcgtcctttacaagtttgatattattgatagatgtttcagtcatgataca
gtggaggaaattgttgaagctttggagaaggaggcagttgagtcttcagatgagtggtgt
ttgacaactcttcggaaaataagagaagcgtccccattgagtttgaaagttattttgcga
tctatacgggaaggtagatttgaaactcttgatcaatgtcttgtacgggagtaccgtgta
tccgttcagacaatttccaagaatgtttcctctgatttcgttgagggtgttcgagcacga
atggttgataaagattttgcacccaagtgggatccaccaactttaaaagatgtatcagag
gacatggttgaccattatttctctcctccgttaaacgaacttgagccagaactggtgctg
cctacagcattgcgagaaccttacatgtga

DBGET integrated database retrieval system