KEGG   Medicago truncatula (barrel medic): MTR_1g014040Help
Entry
MTR_1g014040      CDS       T01716                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00280  Valine, leucine and isoleucine degradation
mtr00410  beta-Alanine metabolism
mtr00640  Propanoate metabolism
mtr01100  Metabolic pathways
mtr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTR_1g014040
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTR_1g014040
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTR_1g014040
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     MTR_1g014040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 11427294
NCBI-ProteinID: XP_003588857
UniProt: G7I876
Position
1
AA seq 409 aa AA seqDB search
MQRFKSLLPQTRFSSRTLSSHPRSFSALPNYAQRNDEEEDSQNQILVEGRAKSRAAILNR
PASLNALTTSMVARLKRLYDSWEENSDIGFVLMKGRGSAFCSGADVVRLYHSLNEGKAEE
AKEFFKTLYSFVYLQGTYLKPHVSILDGRTMGCGSGISLPGMFRVVTDKTIFSHPEAQIG
FHPDAGASYLLSRLPGYLGEYLALTGDKLNGVEMIACNLATHYSLNARLAWLEERLGKLV
TDDPSVVEASLSQYGDLVFPDRSSVLYKFDIIDRCFSHDTVEEIVEALEKEAVESSDEWC
LTTLRKIREASPLSLKVILRSIREGRFETLDQCLVREYRVSVQTISKNVSSDFVEGVRAR
MVDKDFAPKWDPPTLKDVSEDMVDHYFSPPLNELEPELVLPTALREPYM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcagagattcaaatctctgcttccacaaactcgcttctcatctcgcactctctcttct
catcctcgttctttctctgctctaccaaattacgctcaacgcaatgacgaagaagaagat
tcccaaaaccagattttggttgaaggaagagcgaaatcgcgtgcagccattctcaacagg
ccagcttctttgaacgcgcttactacttcaatggttgctaggttgaagaggctttacgat
tcatgggaagaaaactctgatattggttttgttctaatgaagggtagaggcagcgctttc
tgttctggtgcagatgttgttaggctgtatcactcgctcaatgaaggaaaggctgaagaa
gctaaagagtttttcaaaacattatattcatttgtatatcttcaagggacatatcttaaa
ccacatgtttctattttggatggaaggacaatgggctgtggatctgggatttctcttcca
ggaatgttccgtgtggtgactgataaaactattttttctcacccagaggctcaaataggc
ttccaccctgatgctggagcttcttaccttttgtctcgtctacctggctacttaggggaa
tacttggctcttacaggagataagcttaatggtgtagaaatgattgcttgcaaccttgct
acacattattcactaaatgcaaggcttgcttggcttgaagaacgccttggtaaattggtc
acagacgatccatctgttgtagaggcatctctatcacaatatggtgatcttgtttttccc
gacagaagtagcgtcctttacaagtttgatattattgatagatgtttcagtcatgataca
gtggaggaaattgttgaagctttggagaaggaggcagttgagtcttcagatgagtggtgt
ttgacaactcttcggaaaataagagaagcgtccccattgagtttgaaagttattttgcga
tctatacgggaaggtagatttgaaactcttgatcaatgtcttgtacgggagtaccgtgta
tccgttcagacaatttccaagaatgtttcctctgatttcgttgagggtgttcgagcacga
atggttgataaagattttgcacccaagtgggatccaccaactttaaaagatgtatcagag
gacatggttgaccattatttctctcctccgttaaacgaacttgagccagaactggtgctg
cctacagcattgcgagaaccttacatgtga

DBGET integrated database retrieval system