KEGG   Medicago truncatula (barrel medic): MTR_1g015970Help
Entry
MTR_1g015970      CDS       T01716                                 

Definition
(RefSeq) fructan exohydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MTR_1g015970
   00500 Starch and sucrose metabolism
    MTR_1g015970
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MTR_1g015970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 551 aa AA seqDB search
MENIREDASPNNINSEQPYRTWYHFQPLKNWMNDPNGPMYYKGVYHLFYQYNPDAATFGH
EKMVWGHSISNDLINWTHLNDAIVPTIPGDINSCWSGSATILPGEKPAMLYTGIDQNRHQ
VQNLAMPKNLSDPYLREWEKHPQNPLMTPPSGVEVGEFRDPSTAWQGKDGKWRVIIGAQN
GDEGKIILYKSEDFVKWIVDPIPFFATDDTGVCECPDFFPVYINNTNGVDTTMENSSVRH
VLKISYLRRRHDYYFIGKYVSDKEEFVPDVKYTGTWKELRFDYGKVYASKSFFDHAKNRR
ILWAWAEESDTSEDDIQKGWAGLQTIPRKFWLDKNGKQLMQWPIEELEKLRGKQINITGE
TLQSGSTLEVKGITASQADVEVLFELPNLQSAELLEPSEVDPQELCKEQYASRNGMIGPF
GLQALASKDQTERTTISFRIYRAGDGFKCLMISDQTRSSLREDVEKTSYATIFDIDPNLK
TISLRSLIDRSIIESFGDGGRACITSRAYPLFATDKDAHLFVFNDGSQSVVISQLNAWSM
KQAQFGTESII
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggagaacattagagaggatgcatccccaaacaatatcaattctgaacagccatacaga
acttggtaccactttcagcccctaaaaaattggatgaatgatcctaatggaccaatgtac
tataaaggtgtttaccatttattctaccaatataaccctgatgcagcaacatttggtcat
gagaaaatggtatggggtcattctatatcaaatgatctcataaattggactcatctaaat
gatgctattgtaccaactatacctggtgacataaacagttgttggtcaggttcagccact
atactcccaggtgaaaaacctgctatgttgtatacaggaattgatcaaaatagacaccaa
gttcaaaatttagccatgccaaagaatctgtctgatccttacttaagggaatgggaaaaa
catcctcaaaatcctttgatgactccacctagtggagttgaagtcggtgaattccgagat
ccttcaactgcatggcaaggaaaggatggaaaatggagggtaattattggtgctcaaaat
ggagatgaaggaaaaattattctttacaaaagtgaggattttgttaagtggatagtggat
cctatacctttctttgcaacagatgataccggagtttgtgaatgtccagatttttttcct
gtgtatatcaataacacaaatggagttgatacaactatggaaaattcaagtgttagacat
gtcttgaagataagctatctacgtagacgtcatgactattactttattggaaaatatgta
tctgataaggaagagtttgttcctgatgtaaaatatactggaacttggaaggaattgaga
tttgactatggaaaggtttatgcttcaaagtcattttttgaccatgctaagaacaggaga
atattatgggcatgggcggaagagtccgacactagtgaagatgacattcaaaaaggatgg
gctggtcttcagacaattccaaggaagttctggcttgataagaatgggaagcaattaatg
caatggccaattgaagagttagaaaaacttcgtggcaaacaaatcaatatcaccggagaa
acactccaaagtggatcaactcttgaagtaaaaggtatcactgcatctcaggctgatgtg
gaagtcttgtttgagctacccaatctacaaagtgctgagttgctagaaccaagtgaagtt
gatcctcaagaactctgtaaagaacaatatgcatcaagaaatggcatgataggaccattt
ggtttgcaagctttagcatcaaaagaccaaacagagaggactacaatatctttccgaata
tatagagccggcgatggattcaaatgcttgatgataagtgaccagaccaggtcttcattg
cgggaggacgttgaaaaaacctcatatgcaactatctttgacattgatcccaatctcaaa
acaatttcacttagaagcttgattgaccggtccattatagagagttttggagatggaggg
agagcttgcataacaagtagagcttatcccttatttgctacagataaagatgcacatctt
tttgtattcaatgatggaagccaaagtgtggttatctcacaactgaatgcttggagcatg
aagcaagcacagtttggcacagaaagcataatatag

DBGET integrated database retrieval system