KEGG   Medicago truncatula (barrel medic): MTR_1g019480Help
Entry
MTR_1g019480      CDS       T01716                                 

Definition
Alpha amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTR_1g019480
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MTR_1g019480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 402 aa AA seqDB search
MKFLHSICFLCLCISIFPSFSSSAILFQGFKWASSEKEGGWWNFLKTKVPDIADAGVEYV
WLPPPSNSHDDGPQGYLPKRLYDLDTSKYGNKQELKSLVAAFREQGVKSISDIVINHRTA
ERLDNNGLSIFEGGTPDNRLDWDVSYICGNDVQFKGTGNNDTGDDWGGAPDVDHTNPKVQ
QELSDWMNWFTKNYVEKTSPDFTVGELYRNVELGSDGKPLANQDKHRETLVKWVNDAGGV
VTTFDFTTKMILGAAVQGELWRMKDANGKPPGMIGIMPSNAVTFVDNHDTGSQKLWPFPD
DKVMLGYVYILTHPGHPTIFYDHYIEWGLMEPIKKLTAIRKRNGITATSNVNILAAENDL
YMANIGNKIIVKIGPKLDLGNLLPPNAQVATSGQDYAVWEIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctccattcaatatgcttcctttgcctttgcatttctatttttccctctttt
tcttcctctgccatactatttcaggggttcaagtgggcatcaagtgaaaaagaaggagga
tggtggaatttcctgaagaccaaggtccctgacatagcagatgctggtgttgaatatgtt
tggcttcctcctccttccaactctcatgatgatggtcctcaaggttacttgcctaaaagg
ctatatgatcttgacacatccaaatacggcaacaagcaagaactgaagtcattagtagca
gcatttcgtgaacaaggagtaaaatccatatctgatatagtcataaaccacagaacagca
gagaggttagacaacaatggacttagcatcttcgaaggtggtactcccgacaatcgtcta
gattgggatgtgtcctacatttgtggcaatgatgttcaatttaaaggcacgggaaacaac
gacacaggagatgattggggaggagcacctgacgtcgatcacacaaatccgaaagtacaa
caagagttatcagattggatgaattggttcacaaaaaactacgtggagaaaacctcgcct
gatttcacagttggagagctttatagaaacgtcgaattaggttcagatggaaaaccattg
gctaatcaagataagcaccgtgaaactttagttaaatgggttaatgatgctggtggtgtt
gttactacttttgattttactactaagatgattttaggtgctgctgttcaaggtgaactt
tggaggatgaaagatgctaatggaaaaccacctgggatgattggaataatgccatcaaat
gctgttacttttgtggataatcatgatactgggtctcagaaattatggccatttccagat
gataaagttatgttgggttatgtttatattcttactcatcctggtcaccctacaattttc
tatgatcactacatagaatggggactaatggagcctataaagaaattgacagcaataagg
aagaggaatggaattacagcaacaagcaatgtgaatattttggcagctgagaatgatctc
tatatggctaatattggcaacaaaattattgttaagattggacctaaattggatcttgga
aaccttcttccacccaatgcacaggtagctaccagtggacaagattatgctgtatgggaa
attaagtga

DBGET integrated database retrieval system