KEGG   Medicago truncatula (barrel medic): MTR_1g041240Help
Entry
MTR_1g041240      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MTR_1g041240
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MTR_1g041240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1119 aa AA seqDB search
MTITTTPPLEQQNLEEDTEMLVPNSDAVVVEGPQPMEVVQAENTSTVDAVAVEDPPIGRF
TWTIDNFSRLPKKHYSDVFTVGGYKWRILIFPKGNNAEHLSMYIDVADAGSMPYGWTRFA
QFSLTVVNQVHSKYSVRKETQHQFNARESDWGFTNFMPLAELYDPSRGYVVEDRCILEAD
VNVRKDLDYWAHDSKKETGCVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMP
SGSIPLALQSLFYKLQYNDSSVSTKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMK
GTVVEGTIQKLFEGHHMNYIECMNVDYKSTRKESFYDLQLDVKGCTDVYASFDKYVEVEQ
LEGDNKYHAEQYGLQEARKGVLFIDFPPVLQLQLKRFEYDFARDTMVKINDRYEFPLQLD
LDRDDGKYLSPDADRSIRNLYTLHSVLVHSGGVHGGHYYAYIRPTLSNQWFKFDDERVTK
EDTNRALEEQYGGEEELPLTNPGFNNSPFKFTKYSNAYMLVYVRESDKDKIICNVDEKDI
ARHLQIRLKKEQEEKEKKKKEKAEAHLYTIVKIARDDDLHEQIGKDIFFDLVDHDKVRSF
RIQKQMPFTIFKEEVAKEFGIPVEYQRFWMWAKRQNHTFRPSRPVTAQEEAQAVGQLREV
SNKANNGELKLFLEIEMGQDLRPIPPPEKLKEELLLFFKLYEPSSQKLRYVGRLFVVGSR
KPVDILKKLNEMAGFDPDEEIDLFEEIKFDPKIMCEHVDQKSTFRDNQLEDGDIICFQKS
PPAGDGQQQYCYPDVPSFFEYVQNRQVVRFRFLEKPKEDEFSLELSKLHTYDDVVERVSQ
HLGLNDPSKIRLTSHNCYSQQPKPQPIKYRGVDHLSEMLVHYNQASDILYYEVLDIPLPE
LQNLKTLKIAFHHDAKDEVMIIRLQKHSTVADVINDLKSKVDLSHPDAELRLVEVFNHKI
YKIFHVNEKIENINDHYWTLRAEEIPEEEKSLGPHDRMIHVYHFLKDTAQNQMHVQNFGD
PFFLVIREGETLADVKLRVQKKLQVPNEEFLKWKFAFVSLGRPEYLQDSDIISSRFQRRD
IYGAWEQYLGLEHTDNSPKRSYTANQNRHAFDKPIKIYN
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaccaccactcctccgttagagcaacagaatcttgaagaggatactgagatg
cttgttcctaactctgatgctgttgttgttgaaggtcctcaacctatggaagtagttcaa
gcagaaaacacaagtacagttgatgctgtggcagttgaagatccgccaattgggagattc
acatggactattgacaatttttcgaggcttccaaagaaacattattccgatgttttcact
gttggcggctataaatggcggatactgatctttccgaaggggaacaatgctgaacatctg
tcaatgtatatagatgttgcagatgcagggtcaatgccttatggttggactagatttgca
cagttcagcttaactgtggtcaatcaggttcacagtaaatattccgtcagaaaagaaaca
cagcatcagtttaatgcgcgtgaaagtgattggggtttcactaatttcatgcctcttgct
gaattgtatgatcctagtagaggctatgttgtggaagacagatgcatacttgaggctgat
gtgaatgtgcgcaaagatcttgattactgggcacatgactcaaaaaaagaaactggttgt
gtcggtttgaaaaaccaaggagctacttgttacatgaattctcttcttcagacactgtat
cacattccttatttcagaaaggctgtgtaccatatgcccacgactgaaaatgatatgcca
tctgggagcatccctctggcattacagagtttgttttacaagttgcagtataatgacagc
agtgtatcaacaaaagagttaaccaaatcttttggatgggatacttatgattcattcatg
cagcatgatgtccaagaacttaacagggttctctgtgaaaagctagaagacaaaatgaag
ggaactgttgtggaaggcactatacagaagttgtttgaaggccaccatatgaactatatt
gaatgcatgaatgtggattataaatcaacaagaaaagaatcattttatgatcttcagctt
gatgtcaaaggctgtacagatgtgtatgcttcttttgataagtatgtggaagtagaacag
cttgagggtgataacaagtatcatgcagagcagtatggtttacaggaagcaagaaagggt
gtattgttcattgattttccacctgttcttcagcttcagttaaaacggtttgagtatgat
tttgcacgagacactatggtaaagatcaatgaccgctatgagttccccttacaattagat
cttgatagggatgatgggaagtatctatctcctgacgcagacagaagtattcgcaacctt
tatacacttcacagtgttttggttcacagcggtggagttcatggtggacactactatgct
tatatacgcccgactctttcaaatcagtggtttaaattcgatgatgaacgggtaacaaaa
gaagatacaaacagggctttagaagagcagtatggtggtgaagaagagttacctcttaca
aatcctgggttcaacaactctccttttaaatttacaaagtactcaaatgcttacatgctt
gtctatgttcgtgaaagtgacaaggataagataatttgtaatgtggatgagaaggacatt
gccaggcaccttcaaataaggttaaagaaagaacaagaggaaaaagagaagaagaagaag
gaaaaggctgaggctcatttgtacaccattgtaaagattgcccgtgatgatgatctgcac
gagcaaatcggaaaggatattttctttgatcttgtggatcatgataaagtgcgaagtttt
cgcattcaaaaacagatgccatttaccattttcaaggaagaagttgcgaaagagtttggc
ataccagttgagtaccaacgtttttggatgtgggcaaagcgccaaaaccatacatttcgg
ccaagtagaccagtgacagctcaggaggaagcacaggcagttggacagttgagggaagtt
tccaataaggcaaataatggagagttaaagttatttttggaaatagaaatggggcaggat
ttgcgtcctattcctcctcctgagaagctgaaagaggagttgttgctattctttaaactt
tatgaaccttcaagtcagaagcttaggtatgttgggaggcttttcgtggtgggtagcaga
aagccagtagatatattgaagaaactaaatgaaatggctggatttgatccggatgaagaa
attgatttgtttgaggaaataaaatttgatcccaaaatcatgtgcgaacatgttgaccag
aagtccacttttcgtgacaatcagctagaggatggtgatattatttgctttcagaagtct
cctccagctggcgatggacagcagcaatattgttatccagatgttccttcattctttgaa
tatgtgcaaaaccgtcaagttgttcgctttaggtttttggagaaacccaaggaagatgag
ttcagtcttgagctgtcaaagcttcacacttatgatgatgttgtagaaagagtctcccaa
catcttggtttaaatgatccttctaaaatcagacttacatctcataactgctactcccag
caacctaaaccacagcctatcaagtaccgaggagtggatcatttgtctgaaatgctggtt
cactacaatcaggcttctgatattctatactatgaagtactggatattcctcttccggaa
ttgcaaaacctaaaaacgctgaagattgctttccatcatgatgccaaggatgaagtgatg
ataattagattacagaagcacagtactgtggcagatgtaattaatgatctaaaatcaaag
gtagatttatcacatcctgatgcggaacttagattggttgaagtatttaatcacaagatc
tataagatttttcatgtcaatgagaagattgagaatattaatgatcattattggacatta
cgagcagaggagatcccggaagaagagaaaagccttggtcctcatgatcggatgatacat
gtttatcattttttgaaagatactgctcaaaatcagatgcatgttcagaactttggagac
cctttcttcttggttatccgtgagggtgagactttagctgatgtcaaattgcgggtacaa
aagaagttgcaagttccaaatgaggagtttttgaagtggaagtttgcgtttgtctcactt
ggacgtcctgagtaccttcaagattcagatattatttccagtcggtttcagagaagggac
atctacggcgcatgggagcaatatcttggactggagcacactgacaattcacctaaaaga
tcatacacagccaatcagaatcgtcatgcgtttgataaaccaataaaaatctacaactag

DBGET integrated database retrieval system