KEGG   Medicago truncatula (barrel medic): MTR_1g045130Help
Entry
MTR_1g045130      CDS       T01716                                 

Definition
Eukaryotic translation initiation factor 4E-2
Orthology
K03259  
translation initiation factor 4E
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_1g045130
Translation factors [BR:mtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MTR_1g045130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 205 aa AA seqDB search
MATTEPIVEGATAAEEVAAVPVPAPETGLKHKLERRWTFWYDNQSKPKQGAAWGSTLRKV
YSFDTVEEFWCLHDQIFKPSKLPSNADFHLFKDGIEPKWEDPECANGGKWTLTSKSKGNL
DTMWLETLMALIGEQFGDTEDICGVVVSVRQWQDKLSLWTKTAANESNQMSIGRKWKEII
DVSDKMTYNFHEDAKTRGAKARYTV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacagaaccaatcgttgaaggcgctaccgcggcagaggaagtggcggcggtt
ccggtacccgctccggagacagggctaaaacacaaactagagagaagatggactttctgg
tacgataaccaatccaaacctaaacaaggtgctgcttggggatccactcttcgtaaggtt
tactcctttgacaccgttgaagagttttggtgcttgcatgatcagatattcaagcccagc
aagttgcctagcaatgctgactttcacttgtttaaggatgggattgaaccaaaatgggaa
gatcccgagtgtgccaatggaggaaagtggactctcaccagcaaatcaaagggcaatctt
gataccatgtggctcgaaactttgatggctttgattggcgagcaatttggagacactgag
gacatttgcggcgtagttgtgagtgtgcgccagtggcaagacaaactttcattgtggacg
aaaacagccgcaaatgagtcgaaccagatgagcattggaaggaagtggaaggaaatcatt
gatgttagcgacaagatgacatataactttcatgaagatgctaaaacccgaggtgcaaag
gctcgatacactgtataa

DBGET integrated database retrieval system