KEGG   Medicago truncatula (barrel medic): MTR_1g045130Help
Entry
MTR_1g045130      CDS       T01716                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03013  RNA transport
Module
mtr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_1g045130
Messenger RNA biogenesis [BR:mtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     MTR_1g045130
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MTR_1g045130
Translation factors [BR:mtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MTR_1g045130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 11434979
NCBI-ProteinID: XP_003590157
UniProt: G7I6M4
Position
1
AA seq 205 aa AA seqDB search
MATTEPIVEGATAAEEVAAVPVPAPETGLKHKLERRWTFWYDNQSKPKQGAAWGSTLRKV
YSFDTVEEFWCLHDQIFKPSKLPSNADFHLFKDGIEPKWEDPECANGGKWTLTSKSKGNL
DTMWLETLMALIGEQFGDTEDICGVVVSVRQWQDKLSLWTKTAANESNQMSIGRKWKEII
DVSDKMTYNFHEDAKTRGAKARYTV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacagaaccaatcgttgaaggcgctaccgcggcagaggaagtggcggcggtt
ccggtacccgctccggagacagggctaaaacacaaactagagagaagatggactttctgg
tacgataaccaatccaaacctaaacaaggtgctgcttggggatccactcttcgtaaggtt
tactcctttgacaccgttgaagagttttggtgcttgcatgatcagatattcaagcccagc
aagttgcctagcaatgctgactttcacttgtttaaggatgggattgaaccaaaatgggaa
gatcccgagtgtgccaatggaggaaagtggactctcaccagcaaatcaaagggcaatctt
gataccatgtggctcgaaactttgatggctttgattggcgagcaatttggagacactgag
gacatttgcggcgtagttgtgagtgtgcgccagtggcaagacaaactttcattgtggacg
aaaacagccgcaaatgagtcgaaccagatgagcattggaaggaagtggaaggaaatcatt
gatgttagcgacaagatgacatataactttcatgaagatgctaaaacccgaggtgcaaag
gctcgatacactgtataa

DBGET integrated database retrieval system