KEGG   Medicago truncatula (barrel medic): MTR_1g072720Help
Entry
MTR_1g072720      CDS       T01716                                 

Definition
Non-lysosomal glucosylceramidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MTR_1g072720
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MTR_1g072720
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MTR_1g072720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 992 aa AA seqDB search
MVSGNLFHSRKNSWPTEEYINKTTLQLFDIDNAAPPEQAWRRRLNSHANLLKEFRVTFME
AIKMVRLGIRMWSYVREEASHGRKAPIDPFTRESCKPSASQGVPLGGMGSGSISRGFRGE
FRQWQIIPGLCEPSPVMANQFSIFVSREGGNKSFASVLAPGQHEGVGACRKADDQGISSW
GWNLNGQHSTYHALFPRAWTVYDGEPDPELKISCRQISPFIPHNYRESSLPAAVFVYTLV
NTGKERAKVSLLFTWANSIGGNSHLSGDHVNEPFIAEDGVSGVLLYHKQVVEYFRTAKDN
PPVTFSIAACETQNVSVSVLPCFGLSDRSSVTAKGMWTKMVKDGQFDRENFSSGPSMPSS
PGETLCAAVAASAWVEPHGKCTVAFSLAWSSPKVKFVKGSTFNRRYTKFYGTSERAAVHL
AHDALTHYTRWEEEIAKWQDPILKDEKLPEWYKFTLFNELYFLVAGGTIWIDSTLLSSNK
RNNSQDQLEESENAVVRITEAKVDCRKREVVECTTDNSYDSTAHRGHNHLDEKHNRDISR
ENGTVNTLGKGNSANTPHHSTMKNLQHDDDNDDGGRFLYLEGVEYVMWCTYDVHFYASFA
LLMLFPRIELNIQRDFAQAVLCEDGRKVKFLAEGNWGTRKVYGAVPHDLGTHDPWHEMNA
YNIHDTSKWKDLNPKFVLQVYRDFSATGDLQFGVDVWPAVRAAMEYMEQFDRDADGLIEN
DGFPDQTYDTWTVHGVSAYCGGLWLAALQAAAAMALQLGDRDFAETCKRKFLKAKPVYEQ
KLWNGSYFNYDSGSSSNSKSIQADQLAGQWYTASSGLPSLFDDFKIKSSLRKVFDFNVMK
VKGGRMGAVNGMHPNGKVDETCMQSREIWAGVTYGVAATMILAGMEEEAFTTAEGIFLAG
WSEEGSGYWFQTPEAFTIDGHYRSLIYMRPLSIWGMQYALTMPKAVLEAPKINFMDRIHL
SPVSGGLHKETGVKKIATKTKCFSSSVFNCAC
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atggttagcggcaacttatttcattctagaaagaattcgtggcctactgaagagtatatc
aataaaaccactttacaattgtttgatattgataatgctgctcctcctgagcaagcttgg
agaagaagattaaacagccacgccaatcttcttaaagaatttagagtaacttttatggaa
gctataaagatggttcgattaggtatacgcatgtggtcatatgttagggaagaggcttct
catggaaggaaagcacccatagatcccttcactcgagaaagttgcaagccatctgcatct
caaggggttccacttggagggatggggagtggcagcatatcaagaggatttagaggagaa
ttcagacaatggcaaatcattcctggtctatgtgaaccatcacctgtcatggccaaccag
ttctctatttttgtaagtagagagggaggaaacaaaagttttgcatcagttttggctcct
ggtcagcatgaaggtgtaggagcttgcaggaaagctgatgatcagggtatatcatcatgg
ggatggaatctaaatggccagcactcaacttaccatgctttgtttccaagagcttggact
gtttatgatggtgagccagacccagaactaaaaatatcatgtcggcagatatcccctttc
ataccacataattacagagaaagcagtctacctgcagccgtttttgtctatacgttggta
aacactggtaaagaaagagctaaagtcagccttttatttacttgggcgaattctattggt
gggaactctcacttgtcaggagatcatgtgaatgaacctttcatagctgaagatggtgtc
tccggcgtacttctatatcacaagcaagtcgttgaatatttcaggacagcgaaagacaac
ccccctgttactttttcaattgctgcatgtgaaacacagaatgttagtgtttctgttttg
ccatgttttgggctgtccgaccgaagtagcgtaacagcaaaaggaatgtggactaaaatg
gtgaaggatgggcaatttgatcgggaaaatttctcttctggacccagcatgccctcatca
cctggagagacactatgtgctgctgttgcagcttctgcatgggtggaaccccatggaaaa
tgtaccgttgcatttagtcttgcatggtcatctccgaaagtgaagtttgtgaaaggcagc
actttcaacaggagatatacaaaattttatgggacttctgagagagctgcagtgcacctg
gctcatgatgcattgacacattatacacggtgggaagaagagattgcgaaatggcaggat
cctattcttaaggatgagaagctaccagaatggtacaagtttacattatttaacgaactc
tactttcttgttgctggaggaacaatttggatagactctactttgctatcttcaaataag
agaaataatagccaggatcagctagaagagtcggaaaatgcagtagttcgaataactgaa
gctaaagtggactgcagaaaaagggaagttgtcgagtgtacgacagataattcctatgat
tctactgctcataggggacataatcacttggatgaaaaacataatagggatatatcccgt
gaaaatggaaccgtgaatactctcggaaaaggaaactctgctaacactccacatcattca
acaatgaagaatctacaacatgatgatgataatgatgatggtggaaggtttttgtacttg
gaaggtgtggaatatgtcatgtggtgcacatatgatgtgcacttctatgcttcatttgca
cttcttatgctctttcctcgtatcgaattaaatatacaacgcgattttgctcaagctgtc
ctgtgcgaagatggaaggaaagtaaagtttctggcagagggaaactggggaactcgtaag
gtttatggggctgtcccacatgatttggggacacatgatccatggcatgaaatgaatgct
tataacattcatgatactagtaagtggaaagacctgaacccaaaatttgtacttcaggtg
tatcgagatttttctgcaacaggtgatttgcaatttggtgtcgatgtgtggcctgctgtc
cgagctgcaatggagtacatggagcaattcgatagagatgctgatggtcttattgagaat
gacggtttccctgatcaaacatatgatacatggactgtccatggtgtgagtgcttactgt
ggtggtctttggcttgctgctcttcaagctgcagctgcaatggcccttcaactaggtgac
agagattttgcggaaacatgcaaaaggaagtttctgaaggctaagccagtatatgaacag
aagctgtggaatggttcatattttaactatgacagtggatcaagtagtaacagtaaatcc
attcaagccgatcaattggctgggcaatggtatacagcatcctcagggcttccctctctt
tttgatgatttcaagatcaaaagttctctccggaaggtttttgatttcaatgtgatgaaa
gttaaaggcggcagaatgggtgctgtaaatggcatgcatcccaacggtaaggtggatgaa
acctgtatgcagtctcgagagatatgggcaggtgtgacctacggtgttgctgcaacaatg
atacttgcaggaatggaagaagaggccttcacaactgctgagggtatatttctagcaggc
tggtcagaagaaggatccggatactggtttcagactccagaggcatttacaattgacggg
cactatcggtccctcatatatatgaggccactatcaatttggggcatgcaatatgcatta
actatgccaaaggcagtacttgaggcccctaaaatcaacttcatggacagaatccaccta
tctcctgttagtggaggattacataaagaaacaggtgtgaaaaagattgcaacgaaaaca
aaatgctttagcagttctgtgtttaattgtgcttgctga

DBGET integrated database retrieval system