KEGG   Medicago truncatula (barrel medic): MTR_1g075330Help
Entry
MTR_1g075330      CDS       T01716                                 

Definition
DNA repair protein XRCC4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:mtr03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 256 aa AA seqDB search
MEEKKRHTCLKLQLTEEESIFVKGTWFNTHFNLSITDGSTSWHCNASEDEVKQRAAQWDQ
PVEEYVELSERYLGFQQPESVYAFADAGDAHKRLSWTFEKGGMTLHWRWKCMKSPDCKKT
TAEILDFLMDANIRLSEEVVIKTELFEKTKVEAEKCLAQSERIANERVEFESQIYTKFLG
VLNSKKAKLRELRDQLSKQGNGDKSPQEEEDPEKTESFDEESDDGKSDEDPQKCITSSSK
DAGATKRSRPRRTRLA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagaaaagacatacatgcttaaaactacaacttaccgaagaagaatccata
ttcgtcaagggtacatggtttaatactcacttcaacctctccatcaccgacggttccact
tcttggcactgcaacgcatcggaagatgaagtgaagcaacgtgctgctcagtgggaccag
ccggtggaggagtatgttgaattgtctgaacggtatttggggtttcaacaacctgagtct
gtttatgcttttgctgatgctggtgatgctcataagaggttgtcgtggacgtttgagaaa
ggaggaatgacactgcattggagatggaaatgcatgaagtctcctgattgtaagaaaact
actgcagaaatattggactttctcatggatgcaaacataaggcttagtgaagaagttgtc
ataaaaacggagttgtttgagaagacgaaagtagaagctgagaagtgcttggctcagagt
gagagaatagccaatgagagggtggaatttgaatctcaaatctatactaagtttctgggt
gtcttaaattcaaagaaagcaaaactgagagagcttcgagatcagctgtcaaaacaaggt
aacggcgataaatctcctcaagaagaagaagacccagaaaaaactgagagttttgatgaa
gaaagtgatgatggaaaaagtgatgaagatcctcaaaaatgtattactagttcttcgaag
gacgctggagcaactaagcgttctcgtccaaggagaactagactcgcatga

DBGET integrated database retrieval system