KEGG   Medicago truncatula (barrel medic): MTR_1g087520Help
Entry
MTR_1g087520      CDS       T01716                                 

Definition
Protein disulfide-isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MTR_1g087520
Enzymes [BR:mtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MTR_1g087520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 372 aa AA seqDB search
MEMHQIWSRIALASFAFAILFVSVSADDVVVLTEENFEKEVGQDKGALVEFYAPWCGHCK
KLAPEYEKLGNSFKKAKSVLIAKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKFEGP
RTAESLAEFVNTEGGTNVKIATAPSHVVVLTPETFNEVVLDETKDVLVEFYAPWCGHCKS
LAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGR
DLDDFVAFINEKSGTSRDAKGQLTSEVSEFRSKRSIAGIVEDLDELVKEFVAANDEEKKA
VFARIEEEVEKLKGSASRYGKIYLKVSKKYLEKGSGYAKNEIQRLERLLEKSISPAKADE
LTLKKNILSTYA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcatcagatctggagcagaatagcattagcatcgttcgcgtttgcaattcta
ttcgtatcagtttcagcagacgacgtcgttgtgctgactgaagaaaatttcgagaaggaa
gttggtcaagataaaggagctctcgttgagttctacgccccttggtgtggacactgcaaa
aagcttgctccagaatatgaaaagctcggtaacagcttcaagaaagccaaatctgttttg
attgccaaggtggactgtgatgagcataagggtgtgtgcagcaaatatggtgtctctggg
tacccaacgattcagtggtttccaaaaggatctctggaacccaaaaagtttgaagggcca
cgtactgcagaatcacttgccgagtttgtaaacacagaaggaggaaccaatgtgaagatt
gctaccgctccatctcatgtagtggtgctaacacctgaaaccttcaacgaagttgtcttg
gatgaaaccaaagatgtcttggttgagttttatgcaccatggtgtggacattgcaaaagt
cttgctcctatttatgaaaaagttgccgcagtttttaaatcggaggacgatgtagtgatt
gcaaatttggatgccgacaaatatagggacctggctgaaaagtatgatgtaagtggattt
cctaccttgaagttcttcccaaagggcaacaaagccggtgaagattatggaggtggaaga
gacttagatgactttgtggcttttatcaatgagaaatctggaacaagtcgagatgcaaaa
ggacagcttacttctgaggttagtgaattcagatcaaagagaagcattgctggtatagtg
gaagacttggacgaattggtaaaggagtttgtagctgctaatgacgaagagaagaaggct
gtgtttgcccgaattgaagaggaagttgagaagctcaagggttctgcttctagatacggg
aagatttacctgaaagtttctaagaagtacttggagaaaggttctggttatgctaagaat
gaaattcaacgcctagagcgactacttgaaaagtctatcagccctgctaaggccgacgaa
ttgacactcaagaaaaacatcttgtctacatatgcttga

DBGET integrated database retrieval system