KEGG   Medicago truncatula (barrel medic): MTR_1g090300Help
Entry
MTR_1g090300      CDS       T01716                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mtr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mtr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mtr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 543 aa AA seqDB search
MDLSSSSSVYTSFSSLSKTPPSFSLSSSSSSSRQNSLQLLLLRSHLPQRALFLRNPILPP
PFSRQNRLPLAPVRVSNQSENDDGFLLEDVPHLTNFLPNLPSYPNPLQTSQAYSIVKNTF
VSPEDVVAQTIVVQKNSPRGVHFRRAGPREKVYFKAEEVRACIVTCGGLCPGINTVIREI
VFGLKNMYGVEDILGIEEGYKGFYSKNTMRLTPKVVSDIHKLGGTFLRTSRGGHDTHKIV
DNIEDRGINQVYIIGGDGTQKGAARIYEEVEKRRLQVAVAGIPKTIDNDIAVIDKSFGFD
TAVEEAQRAINAAHVEVNSVENGIGIVKLMGRYSGFIAMNATLASRDVDCCLIPESPFYL
EGRGGIFEFIEQRLKENGHLVIVVAEGAGQECVASEVNTVDEKDASGNKLLLDVGPWLSN
KIKDHFTKLPKMVVNMKYIDPTYMIRAIPSNASDNIYCTLLAHSAVHGAMAGYSGFTVGP
VNSKHAYLPIACVTERPNTVQLTGRMWARLLESTNQPSFVSSDQQRVEKEMVEDTNKMNI
TSI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggatctctcctcctcctcctccgtctacacttcgttctcttctctctctaaaactcct
ccttcattttctctctcctcctcctcctcctcctcccgtcaaaactctctgcaactactg
ttgttgcgatcccaccttcctcagcgcgcgctctttctccggaacccgatactaccacca
ccgttttcccgccaaaaccgtctcccactcgcacccgtccgggtttccaatcaatccgaa
aatgacgacggttttctcctcgaggacgttccacacctcaccaatttccttcccaatctg
ccgtcgtatccaaacccactacaaaccagtcaagcttattcaattgtcaagaatactttt
gtaagtccagaagatgtggttgcacaaactattgtcgttcagaaaaatagtcctagagga
gttcattttcgccgtgctggacctcgagaaaaggtttacttcaaggcagaagaagtacgt
gcttgcatagtgacttgtggaggattatgcccaggaattaatacagtgattagggaaatt
gtatttggcttgaaaaacatgtatggggttgaagatatacttgggattgaggaaggatat
aaagggttttattcaaaaaataccatgagattgacacctaaagtggttagcgatatccat
aaacttgggggaacatttcttcgtacatctcgtggaggacatgatacccacaagatagta
gataacattgaggaccgaggaataaatcaggtatacattattggaggtgatggtacccaa
aaaggagctgcacgcatttatgaggaagttgaaaaacgccgtcttcaagtggctgtggct
gggattccgaagacaattgataatgatattgctgtaatagacaaatcttttggatttgat
actgctgtggaagaagcccaaagagccattaatgctgctcatgtggaggttaatagtgtt
gaaaatggaattggaattgttaagctaatgggaagatacagtggttttattgccatgaat
gcaactttggcaagtcgagatgtggattgctgcttgattccagagtctccattttatttg
gaaggaagaggtggaatttttgagtttattgaacagaggttaaaagaaaatggacattta
gttattgtggtagcagaaggagctggtcaggaatgtgttgcttcagaagttaatacagtt
gatgagaaggatgcatcagggaacaagctacttcttgatgttggtccatggttatccaat
aagatcaaggatcatttcacaaagttaccaaagatggtggtaaatatgaaatatatagat
cctacatatatgattcgagctattccaagtaatgcctcggacaacatttactgcactctt
cttgctcatagtgctgtccatggagctatggcaggatattctggcttcacagttgggcct
gtgaacagcaaacatgcttatctcccaatagcttgtgtaacagagagaccaaatacagtc
caactgacaggtaggatgtgggctagacttcttgaatcgacaaatcaaccaagttttgtt
tcctctgaccaacaaagagttgagaaggagatggtcgaagatacaaataagatgaatatt
acttctatataa

DBGET integrated database retrieval system