KEGG   Medicago truncatula (barrel medic): MTR_1g094000Help
Entry
MTR_1g094000      CDS       T01716                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_1g094000
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTR_1g094000
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_1g094000
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MTR_1g094000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 373 aa AA seqDB search
MFELVQLSGNFLSIDWYREHVIKNHNGHQEVMVGYSDSGKDAGRFTAAWELYKAQEDVVA
ACNDYGIKVTLFHGRGGSIGRGGGPTYLAIQSQPPGSVMGTLRSTEQGEMVEAKFGLPQI
AVRQLEIYTTAVLLATLRPPLPPRDENWRSLMEEISEISCKCYRNVVYENPEFLSYFHEA
TPEAELGFLNIGSRPARRKNTKGIGNLRAIPWVFAWTQTRFVLPAWLGVGAGLKGACEKG
HSEELKAMYKEWPFFQSTIDLIEMVLGKADTTIAKYYDEALVSEERQELGRELRNELLTA
EKFVLVISGHEKLQQNNRSLRRLVENRLPFLNPMNLLQVEILKRLRRDDDNLKLRDALLI
TVNGIAAGMRNTG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagctggttcagttatccggaaactttttatcaatagactggtaccgcgagcac
gtcattaagaaccacaatggacatcaagaggttatggttggatattctgattctggtaaa
gatgctggccgcttcactgctgcttgggaactttacaaagctcaggaggatgttgtagct
gcttgcaatgattatggtattaaagttacactgttccatggccgcggaggcagtattggt
cgaggcggtggccctacatatctggctattcagtcccaaccacctggatctgtgatggga
acacttcggtctactgagcagggagaaatggtagaggctaagtttgggttgccacagata
gctgttagacaacttgaaatatacacaactgcagtattacttgcaacccttcgtccacct
ctcccaccccgagatgaaaattggcgtagtctcatggaagaaatctcagagatcagttgc
aagtgttaccgcaatgtagtctacgaaaatccagaattcctttcttacttccatgaagcc
acgcctgaagcagaactcggcttcctcaacataggtagtcgccctgcaagaaggaagaac
acaaagggaattggaaaccttcgtgctattccctgggtatttgcgtggactcaaaccaga
tttgttcttccagcttggcttggagttggagcaggtttgaaaggtgcttgtgagaaaggt
cacagcgaagaactaaaagcaatgtacaaagaatggcctttctttcaaagtacaatagac
cttattgaaatggttttaggtaaagcagacactactatagctaagtactatgatgaagcc
cttgtatcagaggagaggcaagaactcggtcgtgagctaagaaacgagctcctgacagct
gaaaagtttgtgctcgtgattagtgggcacgagaaacttcagcagaataataggagcttg
aggaggttggttgagaacagacttccatttctcaatcccatgaacctgttgcaggtggag
attctgaagaggttgaggcgtgatgacgacaaccttaaactcagagatgctttgcttatc
actgtaaatgggattgctgctgggatgaggaataccggttaa

DBGET integrated database retrieval system