KEGG   Medicago truncatula (barrel medic): MTR_1g097850Help
Entry
MTR_1g097850      CDS       T01716                                 

Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00564  Glycerophospholipid metabolism
mtr01100  Metabolic pathways
Module
mtr_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTR_1g097850
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     MTR_1g097850
    2.7.1.82  ethanolamine kinase
     MTR_1g097850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase APH_6_hur Haspin_kinase UPF0154 DUF357 RIO1 EcsC
Motif
Other DBs
NCBI-GeneID: 11414175
NCBI-ProteinID: XP_003592017
UniProt: G7IAI2
Position
1
AA seq 350 aa AA seqDB search
MAIKTIELLKGSASQEELMEVITAVASDLGDVIDDVNTLQVIPLKGAMTNEVFQINWPTK
NDGDLRKVLVRLYGEGVEIFFNRDEEIRTFECISKHGQGPRLLARFTTGRVEEFIHARTL
SAIDLRDSEISSLVASKMREFHKLHMPGTKKAHIWQRMRNWVGEAKSLYDEINILEKELC
EGYQEIGFCHNDLQYGNIMMDEETRSITLIDYEYASYNPIAYDLANHFCEMAADYHSDTP
HFLDYSKYPELEERQRFIRVYLSSEGKKPSNAKVNQLMTAVEKYTLANHLFWGLWGLISS
YVNKIDFDYKEYARQRFQQYWLRKPTLLDSSTIVAQTETVNGSLPLASCV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccattaagacaattgaattattgaaaggatctgcatctcaagaagaattaatggaa
gtgattactgcggtggcttcggatttaggagatgtcatcgatgatgtgaacactttgcaa
gtgattccattgaaaggtgcaatgaccaatgaagtgtttcagataaattggccaacaaaa
aatgatggtgatttgaggaaggttctggttcgtttatatggtgaaggtgttgaaattttc
ttcaatagggatgaagaaattcgaaccttcgagtgtatctcaaagcatggtcaaggtcca
cgccttcttgctcgtttcactactggtagagttgaggagtttattcatgccagaactctc
tcggctattgatctccgtgactctgaaatatcatctttggtggcatctaagatgagagaa
ttccataagcttcatatgcctggtacaaagaaggctcacatttggcagagaatgaggaac
tgggttggtgaagccaaaagtttgtatgatgaaataaatattctggagaaggagttgtgt
gaaggatatcaagagattggtttttgccacaatgacctacaatatggcaacattatgatg
gatgaagagactagatcaatcaccctaattgactacgaatacgcgagttacaatcctatc
gcgtatgacctggctaatcatttctgtgaaatggcagcagattaccatagtgatacacct
cattttcttgactacagtaaatatcctgaactcgaggagcgtcaaaggttcattcgtgtc
tatctcagttctgaaggcaagaaaccaagcaatgctaaggtgaatcagttaatgacggct
gtagaaaaatatactctcgcaaaccatctattctggggcttatggggacttatttcgagt
tatgtgaataaaattgactttgattacaaagaatatgcaaggcagaggtttcagcaatat
tggttaaggaagcctactttattggactcatcaaccattgttgcccaaaccgaaactgtg
aacggttcgctgccactagcatcatgtgtgtga

DBGET integrated database retrieval system