KEGG   Medicago truncatula (barrel medic): MTR_1g100550Help
Entry
MTR_1g100550      CDS       T01716                                 

Definition
NADH cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mtr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 278 aa AA seqDB search
MDFLQNQKVEVITMAVALVAILGGTAYYYYLTKKPKGCLDPENFKEFKLVKRTQLSHNVA
TFRFCLPNRSSVLGLPIGQHISCRGKDSLGEEVIKPYTPTTLDTDVGYFELVVKMYPQGR
MSHHFSEMREGDYLAVKGPKGRFKYQPNQVKAFGMVAGGTGITPMFQVARAILENPQDKT
NVNLIYANVTYDDILLKEELDDLAIKFPNRFKVYYVLNQPPEIWDGGVGFVSKEMIETQF
PAPAADIKILRCGPPPMNKAMAAHLEDLGYSPQMQFQF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggattttctgcagaatcagaaggtagaggtgataaccatggcagtagctcttgttgcc
attcttggtggtaccgcttactattactatctcaccaagaaacccaaagggtgcttggat
cctgagaatttcaaggaatttaagcttgtcaaacgcactcaactcagtcataatgttgcg
acattcagattttgtcttcctaatcgtagctcagtgttggggcttcctattggacaacat
atcagctgcagaggaaaagacagtcttggtgaagaagtaatcaaaccatatacaccaaca
acattggatactgatgttggatactttgaattggtcgttaagatgtatccacaaggaaga
atgtctcatcacttcagtgagatgcgtgaaggcgattacttagctgtgaaaggaccaaag
ggacgtttcaagtaccaacccaaccaagtaaaagcttttggaatggttgctggtggcacc
ggcatcaccccaatgtttcaggttgcaagagctatactagaaaatccacaggacaaaacc
aacgtaaatttgatatatgccaatgtcacatatgatgacattcttctaaaggaagagctc
gatgacttggcaattaaattcccaaatcgatttaaagtttattatgttctaaatcagcca
ccagaaatatgggatggcggagtcggattcgtttccaaggaaatgattgaaacacaattc
cctgcaccagcagcggatattaagatattaaggtgtggaccacctcccatgaacaaggct
atggctgctcaccttgaagaccttggatacagtccccaaatgcagtttcagttttag

DBGET integrated database retrieval system