KEGG   Medicago truncatula (barrel medic): MTR_1g115820Help
Entry
MTR_1g115820      CDS       T01716                                 

Definition
Chalcone-flavonone isomerase
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:mtr00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 222 aa AA seqDB search
MAASITAITVENLEYPAVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYLEDIAVA
SLAAKWKGKTSQELLDTLDFYRDIISGPFEKLIRGSKIRELSGPEYSRKVMENCVAHLKS
VGTYGDAEAEAMQKFAEAFKPINFPPGASVFYRQSPDGILGLSFSPDTSIPEKEAALIEN
KAVSSAVLETMIGEHAVSPDLKRCLAARLPALLNEGAFKIGN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatcaatcaccgcaatcactgtggagaaccttgaatacccagcggtggttaca
tctccggtcaccggcaaatcatatttcctcggtggcgcaggggagagagggttgacaatt
gaaggaaacttcatcaagttcactgccataggtgtttatttggaagatatagcagtggct
tcactagctgccaaatggaagggtaaaacctctcaagagttactagatacccttgacttt
tacagagacatcatctcaggtccctttgaaaagttaattagagggtcaaagattagggaa
ttgagtggtcctgagtactcaaggaaggttatggagaactgtgtggcacacttgaaatca
gttggaacttatggagatgcagaagctgaagctatgcaaaaatttgctgaagctttcaag
cctattaattttccacctggtgcctctgttttctacaggcaatcacctgatggaatatta
gggcttagtttctctcctgatacaagtatacctgaaaaggaggctgcacttattgagaac
aaggcagtttcatcagcagtgttggagactatgatcggcgagcacgctgtttcccctgat
cttaagcgctgtttggctgcaagattaccggcgttgttgaacgagggtgctttcaagatt
ggaaactga

DBGET integrated database retrieval system