KEGG   Medicago truncatula (barrel medic): MTR_1g115840Help
Entry
MTR_1g115840      CDS       T01716                                 

Definition
Chalcone-flavonone isomerase 2-B
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    MTR_1g115840
Enzymes [BR:mtr01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     MTR_1g115840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 225 aa AA seqDB search
MATAAPTITGVKVENIEFPAVVTPPASPKSYFLGGAGVRGLDIDGEFVKFTGIGIYLEEK
AVASLTPKWKGKTPSQLFESLEFYRDIIKGPFEKFIRSTKVRTLEGSEYVRKVSENCIAH
MKSEGTYGDAEEKAIQEFREAFKDQFFPPGTAAFYRQSPNGALGLRFSKDETIPEHEYAV
INNKPLSEAVLETMIGEIPVSPALKESLATRFYEFLKIDNFNIRN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcagcacccacaatcaccggagtgaaggtggagaatattgaatttccggca
gtggtgacacctcctgcctcccccaagtcctatttcctcggtggtgcaggggtgaggggg
ttagatattgatggagaatttgtgaagttcactggaataggaatttatttggaagaaaaa
gctgtagcatcactcactcctaagtggaaaggcaaaactccatctcagctctttgaatcc
cttgaattctatcgagatatcatcaaaggtccctttgagaaatttattcgaagtacaaag
gtgagaacactagaaggtagtgaatatgtgagaaaggtgtcagaaaattgcattgcccat
atgaaatctgaaggaacatatggcgatgcagaagaaaaagccattcaagaatttagagaa
gcttttaaggatcaattttttccaccaggaactgctgctttctacagacaatcaccaaat
ggagcattagggcttagattctccaaagatgagacaatacctgaacatgagtatgctgtt
ataaacaacaagccgctttcggaagcagtgttggagaccatgattggagaaatccctgtt
tcccctgctttgaaagagagtttggctacaagattttatgagtttctgaagattgacaac
ttcaacattcgaaactga

DBGET integrated database retrieval system