KEGG   Medicago truncatula (barrel medic): MTR_2g008410Help
Entry
MTR_2g008410      CDS       T01716                                 

Definition
RNA export
Orthology
K14298  
mRNA export factor
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_2g008410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 351 aa AA seqDB search
MSNFLSNNTNPNPNPNKSIEVNQPPTDSVSSLNFSPKSNLLVATSWDNQVRCWEVARDGA
NNVATMPKASIAHDHPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQPITVAMHDAPIK
DIAWIPEMNLLATGSWDKNIKYWDTRQPNPVHTQQLPERCYAMTVKHPLMVVGTADRNII
VYNLQNPQVEFKRIVSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHLDDSQQAKNFTFK
CHREGNEIYSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMLRCSQPVPCSAFNN
DGSIFAYSVCYDWSKGAENHNPATAKPYIFLHLPQESEVKGKPRIGATGRR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatttcttatcgaacaacacaaatccaaaccctaaccctaacaaatccatcgag
gtgaatcaacctccaactgattctgtttccagtctcaatttcagtcccaaatccaactta
cttgttgctacttcttgggataatcaggttcggtgttgggaggttgctcgtgatggagca
aataacgttgccactatgcctaaggcttctatagcgcatgatcatccggttttgtgctct
gcttggaaggatgatggcacaactgtcttctctggtggatgtgacaagcaagttaaaatg
tggcctctgttgtctggaggacaaccaattactgtagccatgcacgatgcacctatcaaa
gatattgcttggattcccgagatgaaccttttagccacaggaagctgggacaagaatata
aagtattgggatacaaggcagccaaatccagtgcacacacaacaactcccagagcgctgc
tatgcaatgacagtgaaacatcctctgatggtagttggcactgctgatagaaatattatt
gtttacaatttgcaaaatcctcaggttgagtttaagagaattgtttcacccttaaagtat
cagacaaggtgccttgctgcgttccctgatcaacaaggtttcttggttggatcaatagaa
ggaagagttggagtgcatcatttggatgatagtcagcaggctaaaaacttcactttcaaa
tgccacagagaggggaatgaaatatactcagtcaactctttaaacttccatcctgtacac
cacacatttgctacggctggttctgatggtgcttttaatttttgggacaaggatagtaaa
cagaggcttaaggccatgttaagatgcagccaacccgttccttgcagtgcctttaacaat
gatggttcaatatttgcttactcagtctgctatgactggagtaaaggggcagaaaatcat
aatccggcaacagcaaagccgtacattttcctgcacttgccacaggaatctgaggtcaag
ggaaaaccgcgcattggtgcgactggcagaaggtaa

DBGET integrated database retrieval system