KEGG   Medicago truncatula (barrel medic): MTR_2g008410Help
Entry
MTR_2g008410      CDS       T01716                                 

Definition
(RefSeq) plant poly(A)+ RNA export protein
  KO
K14298  mRNA export factor
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_2g008410
Messenger RNA biogenesis [BR:mtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     MTR_2g008410
Chromosome [BR:mtr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    MTR_2g008410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Vitelline_membr
Motif
Other DBs
NCBI-GeneID: 11428530
NCBI-ProteinID: XP_003593160
UniProt: G7INS2
Position
2
AA seq 351 aa AA seqDB search
MSNFLSNNTNPNPNPNKSIEVNQPPTDSVSSLNFSPKSNLLVATSWDNQVRCWEVARDGA
NNVATMPKASIAHDHPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQPITVAMHDAPIK
DIAWIPEMNLLATGSWDKNIKYWDTRQPNPVHTQQLPERCYAMTVKHPLMVVGTADRNII
VYNLQNPQVEFKRIVSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHLDDSQQAKNFTFK
CHREGNEIYSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMLRCSQPVPCSAFNN
DGSIFAYSVCYDWSKGAENHNPATAKPYIFLHLPQESEVKGKPRIGATGRR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatttcttatcgaacaacacaaatccaaaccctaaccctaacaaatccatcgag
gtgaatcaacctccaactgattctgtttccagtctcaatttcagtcccaaatccaactta
cttgttgctacttcttgggataatcaggttcggtgttgggaggttgctcgtgatggagca
aataacgttgccactatgcctaaggcttctatagcgcatgatcatccggttttgtgctct
gcttggaaggatgatggcacaactgtcttctctggtggatgtgacaagcaagttaaaatg
tggcctctgttgtctggaggacaaccaattactgtagccatgcacgatgcacctatcaaa
gatattgcttggattcccgagatgaaccttttagccacaggaagctgggacaagaatata
aagtattgggatacaaggcagccaaatccagtgcacacacaacaactcccagagcgctgc
tatgcaatgacagtgaaacatcctctgatggtagttggcactgctgatagaaatattatt
gtttacaatttgcaaaatcctcaggttgagtttaagagaattgtttcacccttaaagtat
cagacaaggtgccttgctgcgttccctgatcaacaaggtttcttggttggatcaatagaa
ggaagagttggagtgcatcatttggatgatagtcagcaggctaaaaacttcactttcaaa
tgccacagagaggggaatgaaatatactcagtcaactctttaaacttccatcctgtacac
cacacatttgctacggctggttctgatggtgcttttaatttttgggacaaggatagtaaa
cagaggcttaaggccatgttaagatgcagccaacccgttccttgcagtgcctttaacaat
gatggttcaatatttgcttactcagtctgctatgactggagtaaaggggcagaaaatcat
aatccggcaacagcaaagccgtacattttcctgcacttgccacaggaatctgaggtcaag
ggaaaaccgcgcattggtgcgactggcagaaggtaa

DBGET integrated database retrieval system