KEGG   Medicago truncatula (barrel medic): MTR_2g012510Help
Entry
MTR_2g012510      CDS       T01716                                 

Definition
PAP-specific phosphatase HAL2-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MTR_2g012510
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MTR_2g012510
Transfer RNA biogenesis [BR:mtr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MTR_2g012510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 466 aa AA seqDB search
MSFSSTIIRPRMLLGQTTRFNNNDAFTLSHVVQPQPLVRGSCSFSLSTTRHIGFVSKFDQ
TCSSASPIMEDEDQKKFSFFSKSEKEDDEEYSKELDVAVRAVQMACSLCQRVQESLISKT
NHQVQSKDDNSPVTVADWSVQAVVSWILSECLGSENISIVAEEDVQTLSKSNASELLDSV
VKTVNDCLAEAPRFGVQKPKSPLGNSEVLDIISRCNSTGGPSGRFWVLDPVDGTLGFVRG
DQYAVALALVEDGEVVLGVLGCPNYPMRKEWLSYQHRYHRIVSKLTPPTSESWNKGCVLY
AKKGTGKAWMQPLLHVNKMFVWPNHAIQIFVSNIDNPALATFCEPVEKANSSHSFTAGLA
HSVGLRKQPLRVYSMVKYAAIGRGDAEVFMKFARAGYKEKIWDHAAGVIIIQEAGGVVTD
AGGCPLDFSKGLYLEGLDRGIIACSGASLHGKIIDAVDASWGCSSL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctctagcacaataatccgaccacgtatgttgttgggacaaacaacaagattc
aacaacaatgatgcattcacactctcccacgttgttcaaccacaaccacttgtacgaggt
tcttgttccttctcactctcaacgacccgccacattggttttgtttcaaaattcgaccaa
acctgttcttctgcttcacctatcatggaggatgaggatcagaaaaagtttagttttttc
tccaaatcagaaaaagaagatgatgaagaatattccaaggaattggatgttgctgtcaga
gcagtgcaaatggcttgttcactttgtcagagagtgcaggagagtttgatttccaaaacc
aatcatcaggttcagtctaaggatgataattctcctgttactgttgctgattggagtgtc
caagcagttgtgagctggatattatctgagtgtctaggaagcgaaaatatctcaattgta
gctgaagaagatgttcaaactctctccaaatctaatgcatctgaactattagactctgtg
gttaaaactgtgaatgattgcctagctgaagcgcctcgatttggtgttcagaagccaaaa
tcaccacttggaaattcagaagttctcgatattataagtcgctgcaactcaaccggtggt
ccatctggaagattttgggtactagatcctgttgatggcacactcgggtttgttcgtggc
gatcaatatgctgtagctctagcgctcgtagaggatggagaagtagtgcttggtgttctt
ggctgtccaaattaccctatgcggaaggaatggttaagttatcaacaccggtatcatagg
attgtatcgaagttgactcctccaacttctgaaagttggaacaaaggttgtgtgctatat
gctaaaaagggtacaggaaaggcttggatgcaaccattgctacatgtgaataagatgttt
gtgtggccaaaccatgcaatacaaatttttgtctctaacattgacaatccagctttggcc
actttttgtgaaccagttgagaaggccaattcaagccattcttttactgcaggacttgct
cacagtgttggtctcaggaaacaaccattaagagtatacagcatggtaaaatatgcagca
ataggtcgtggagatgcagaggtattcatgaaatttgcaagggcaggttacaaggagaaa
atatgggatcatgctgcaggtgttattatcatacaagaagctggtggagtggtaacagat
gctggagggtgtcccctagacttctcaaaaggattatatttagaaggcttagatcgcggt
ataattgcttgttctggagcctcattgcatggaaagatcattgatgctgttgatgctagc
tggggctgttccagcctttga

DBGET integrated database retrieval system