KEGG   Medicago truncatula (barrel medic): MTR_2g015390Help
Entry
MTR_2g015390      CDS       T01716                                 

Definition
Magnesium-chelatase subunit chlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTR_2g015390
Enzymes [BR:mtr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MTR_2g015390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 422 aa AA seqDB search
MSSTTLGTSSIAFLPSRYLSSPSSNPSIHTLSLTSGQNCSKKLYGGIGISSTKGKSRLPV
VNVATEVNSVEQSLNTISKESARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRG
TGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPEVMGVEVRDRVIKGEQLSIVLSKINMVD
LPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSA
ASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIV
EERARFDKNPKEFRETYKAEQEKLTDQITSARKILSSVQIDQDLKVKISRVCAELNVDGL
RGDIVSNRAAKALAALKGRDQVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEV
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaacaacactaggcacttcttccattgcatttcttccttcacgttacctttct
tctccttcttccaacccttccattcacacactctctttaacctcagggcaaaactgtagt
aagaagctttatggaggaattggaattagtagcacaaagggaaagtctaggttacctgtt
gttaatgttgccactgaagtaaactctgtagaacagagtttgaatactatttctaaagaa
agcgcgaggccggtgtacccttttgctgctattgttggacaggatgagatgaagctttgt
cttctccttaacgtgattgatccaaagattggaggtgtaatgataatgggggacagagga
acagggaaatccacaacggttaggtcattggttgatttacttcctgaaatcaaggttgtt
tttggtgatccatataactcagacccagaagatccagaagtcatgggagtcgaagtgaga
gatcgagttataaaaggggagcaactttccattgtgttgagcaaaatcaacatggttgat
ttgccattaggagctacagaagatagggtgtgtggaacaattgacattgaaaaagctctc
actgagggtgtcaaggcatttgagccaggactattagctaaagctaacagaggaatctta
tatgttgacgaagttaatcttttggatgatcacttggttgatgtgctgttggattctgct
gcatcaggttggaacacagtggagagagaaggtatttctatctcgcatcctgctcggttt
atcttaattggttcgggaaatcctgaagaaggggagctcaggccacaactattggataga
tttggaatgcatgctcaagtcgggactgttagggatgctgagctgagagtgaagattgta
gaggagagagctaggtttgacaagaatccaaaggaatttcgagagacttacaaagccgag
caagagaagctcacagaccaaattacctcggcaaggaagatactttcgtctgttcaaatt
gatcaagatctcaaggtgaaaatctctagggtgtgtgcagagttgaatgtggatggattg
agaggagacatagtatcaaacagagctgctaaagctttggctgctctaaagggaagagac
caagtgactgtagaggatattgctactgtcatccctaactgcttgagacaccgtcttaga
aaggatcctttggagtcaatagattcaggtttacttgtcacagagaaattttatgaagta
ttcagctga

DBGET integrated database retrieval system