KEGG   Medicago truncatula (barrel medic): MTR_2g018260Help
Entry
MTR_2g018260      CDS       T01716                                 

Definition
Eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mtr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 225 aa AA seqDB search
MVVEETPKSIDDQITNPKIEDINNDLEEGEINDDDSSAISKPLTAGHQSHPLENSWTFWF
DNPQTKSKQQAWGSSIRPVYTFSTVEEFWSIYNNIHHPSKLAIGADFHCFKHKIEPKWED
PICANGGKWTVQFSRGKSDTSWLYTLLAMIGEQFDHGDEICGAVVNVRSRAEKISIWTKN
AANEAAQVSIGKQWKEFLDYNETIGFIFHDDAKKLDRAAKNKYVV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagaagaaaccccaaaatccatcgacgatcaaatcacaaaccctaaaatcgaa
gacatcaacaacgatctcgaagaaggagagatcaacgacgatgattcctccgccatttcg
aaacccctcaccgccggtcaccaatctcaccctcttgagaattcctggactttctggttc
gataaccctcagactaaatccaaacaacaagcttggggtagttcgattcgacccgtctac
actttttctactgttgaagagttttggagcatttacaataacattcaccatcctagcaag
ttggctattggagctgatttccattgtttcaagcataagattgaaccaaaatgggaagac
cctatttgtgctaatggtggaaaatggactgtgcaattttctaggggaaaatctgatact
agctggttgtatacgttgttggcaatgattggagagcaatttgatcatggagatgaaatt
tgtggagcagttgtgaatgtcaggagtagggcggaaaaaatttctatatggactaagaat
gctgctaatgaagctgctcaggtgagcatcggaaaacagtggaaggagtttcttgattat
aatgaaaccattggctttatatttcatgatgatgcaaagaagcttgacagagctgctaaa
aacaaatatgttgtatga

DBGET integrated database retrieval system