KEGG   Medicago truncatula (barrel medic): MTR_2g030520Help
Entry
MTR_2g030520      CDS       T01716                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTR_2g030520
  Amino acid metabolism
   00340 Histidine metabolism
    MTR_2g030520
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MTR_2g030520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 478 aa AA seqDB search
MKSALTTCNINWKCYQNHHRTSFSVTNTINYRTRCSISMANPIKTYHLSNLTQTELLSLK
SRPRIDFSSVFDIVNPIVDDVHAHGDAAVKQYTSKFDKVDLENIVELVSDLPDPVLDPAI
KEAFDVAYSNIYAFHAAQKSPEKSVENMKGVQCKRVARSINSVGLYVPGGTAVLPSTALM
LAVPAQIAGCKTIVLANPPTRDGTTCKEVLYCAKKAGVTHLLKAGGAQAISAMAWGTETC
PKVEKIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKHAIPSHVAADLLSQA
EHGPDSQVVLVIAGDGVDQNAIQEEVSKQCQSLPRGEFAAKALSHSFIVHARDMLEAITF
SNMYAPEHLIINVKDAEKWESFIENAGSVFLGSWTPESVGDYASGTNHVLPTYGYARMYS
GVSLDSFLKYITVQSLTEEGLRKLGPYVETMAEVEGLEAHKRAVTLRLQDIEARQVSR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgcgcttacgacttgtaacattaactggaagtgttaccaaaaccaccacaga
acctctttctctgttaccaataccatcaattaccgaacacgctgttccatttccatggca
aatccaatcaaaacctaccatttatccaacctcactcaaaccgaacttctctccctcaaa
tctcgtccacgcatcgatttctcttctgttttcgacattgtcaaccccattgttgatgat
gttcatgctcatggagatgctgctgttaaacaatatacttcaaaatttgataaagttgat
cttgagaatattgttgagctcgtttctgacttacctgaccctgtgcttgatccagcgatt
aaggaagcttttgatgtcgcttacagcaatatttatgcatttcatgctgctcagaagtca
cctgagaaaagtgttgagaacatgaaaggagtccaatgcaagagagttgcaagaagtatt
aattccgtgggtctttatgttccagggggaactgctgtattgccttcaacggctttgatg
cttgcagttcctgcacaaattgccggatgtaaaactattgttcttgcaaatcctcccact
cgggatggcacaacatgcaaggaggtactgtattgtgcgaagaaggctggggtgactcac
ctactcaaagctggaggagcacaggccatatctgctatggcttggggaacagaaacttgt
cccaaggttgagaagattttcggccctggaaatcaatatgtcacagctgcaaaaatgata
cttcaaaatagtgaagccatggtttcaattgacatgccggctggtccatctgaagtttta
gtcattgcggacaagcatgcaattccatctcacgtagctgctgatttgctttcccaggct
gagcatggccctgatagtcaagttgttcttgtgattgctggagacggtgtggatcagaat
gcaattcaggaggaggtcagcaagcagtgtcagagtcttccaagaggtgaatttgccgca
aaagcactgagccacagttttatcgtgcatgcacgtgatatgcttgaggctatcactttc
tcaaacatgtatgcacctgagcatttaatcatcaacgtaaaagatgcagagaagtgggag
agttttattgagaatgcaggttctgtgtttttagggtcgtggacaccggagagtgtcggt
gattatgcaagtgggacaaaccatgtccttcctacttatggatatgcaagaatgtatagt
ggcgtgtcattggactctttcctcaagtacataactgtacagtctctcacagaggaaggt
ctaagaaaacttggaccatatgtagaaaccatggctgaagttgaaggacttgaagcgcac
aagcgagccgttaccttgagacttcaggacatagaagccagacaggtttcaagatga

DBGET integrated database retrieval system