KEGG   Medicago truncatula (barrel medic): MTR_2g035810Help
Entry
MTR_2g035810      CDS       T01716                                 

Definition
Choline-phosphate cytidylyltransferase
Orthology
K00968  
choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTR_2g035810
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     MTR_2g035810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 285 aa AA seqDB search
MNEQDDSEVGKNDKPVRVYADGIYDLFHFGHARSLEQAKKSFPNTYLLVGCCSDEITHKY
KGKTVMNEQERYESLRHCKWVDEVIPDVPWVINQEFIDKHKIDYVAHDALPYADTSGAGN
DVYEFVKAIGKFKETKRTEGISTSDIIMRIIKDYNQYVMRNLDRGYSRKELGVSYVKEKR
LRMNMGLKKLQERVKKQQETVGKKIGTVRRIAGMNRTEWVENADRLVAGFLEMFEEGCHK
MGTAIRDRIQEQLKAQQLKSLLYDEWDDDVDDEFYEDESVEYYSD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaagatgactctgaagttggcaaaaacgataaacctgttcgtgtttatgct
gatggtatctacgatctctttcactttggtcatgcccgttctcttgaacaagccaagaaa
tcgtttccgaatacatatctccttgttggatgctgcagtgatgagatcacacacaagtac
aagggtaaaactgttatgaatgagcaagaacgctacgagtctcttcgtcattgcaagtgg
gttgatgaagttattccagatgtgccgtgggtaatcaatcaggagttcattgacaagcat
aaaattgactatgtggcacatgatgctcttccttatgctgatacaagtggagctggaaat
gatgtctatgaatttgttaaggctattgggaaatttaaggaaacaaagcggactgaagga
atttctacctctgatatcataatgagaatcatcaaagattataatcagtatgtaatgcgt
aatctggatcgtggttattcaagaaaggagctaggtgttagctatgtcaaggagaaaaga
ttgagaatgaacatgggacttaaaaagttgcaggagagagtcaagaaacagcaagagact
gtaggaaagaagataggaacagtgagaagaattgccgggatgaaccgtaccgaatgggtt
gaaaatgcagatcgattagttgctggatttctcgagatgtttgaagaaggatgccacaaa
atgggaacagcaatcagagacagaattcaagaacagctgaaggcacagcagctaaaatct
cttctttatgacgagtgggatgatgatgttgacgacgaattctacgaagatgaatctgta
gaatactacagcgactaa

DBGET integrated database retrieval system