KEGG   Medicago truncatula (barrel medic): MTR_2g045490Help
Entry
MTR_2g045490      CDS       T01716                                 

Definition
Mitochondrial pyruvate dehydrogenase kinase isoform
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     MTR_2g045490
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   MTR_2g045490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 369 aa AA seqDB search
MAAKKAIETFSKSLIEEVHKWGCFKQTGVSLRYMMDFGSKPTSKNLLISAQFLHKELAIR
IARRAVELERLPCDLSQKPAVLKVRDWYLDSFRDIRSFSEIKNMNDEKEFTEVIKAIKVR
HNNVVPTMALGVQQLKKDVDPKIINQDFVEIHQFLDRFYMSRIGIRMLIGQHVELHSPNP
PPHVVGYIHTRMSPVEVARNAVDDARSICSRQYGSAPDVHIYGDPDFTFPYVPAHLHLMV
FELVKNSLRAVEERYMNSDKDPPPIRIIVADGLEDVTIKISDEGGGIPRSGLRKIFTYLY
STARNPLDEHADLGVGDNVTMAGYGYGLPISRLYARYFGGDLQIISMENYGTDAYLHLSR
LGDSQEPLP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaagaaagctattgaaacattctccaaaagcttgatagaagaagtacacaaa
tggggttgtttcaaacaaactggtgtgagtttaagatacatgatggattttggttctaaa
ccaacttccaagaatttgttgatttctgcacagtttcttcataaggaacttgccattaga
attgctagaagagctgttgagcttgaaaggcttccttgtgatttgtcacaaaaacctgct
gttttgaaggttagagattggtacttggattcgttccgcgatattagatccttttctgag
atcaagaacatgaatgatgaaaaagaattcactgaagtgatcaaggccataaaagtgaga
cacaacaatgtggtacctacaatggccttaggtgttcagcaattgaaaaaagatgtggac
ccaaagattattaatcaggattttgttgagattcatcagttccttgatcgtttttacatg
tcaagaatcggaatccgaatgctcatagggcagcatgttgagttgcacagtccaaatcct
cctcctcatgtcgtaggttatatacatacaagaatgtctccggtggaggtagcaaggaat
gccgttgacgatgcacgctctatatgctctcgtcaatatggaagtgcccctgacgtacat
atctacggtgatcctgattttacttttccgtatgttccagcacacttgcatcttatggta
tttgagttggttaagaactctttgcgtgccgttgaagagcgttatatgaattccgacaaa
gatccacctcccataagaataatagttgctgatggattagaggatgttaccataaagatt
tcggatgagggaggtggaataccaagaagtggtctgcgaaagatttttacatatctgtat
agtactgctagaaatccattggatgagcatgccgatcttggagttggcgataatgtgaca
atggctggatatggatatggtcttcctattagtcgtctatatgctcggtattttggtggc
gatcttcaaataatctctatggaaaattatgggactgatgcatatctacatctgtctcgt
ttgggagattcacaagagccattaccttga

DBGET integrated database retrieval system