KEGG   Medicago truncatula (barrel medic): MTR_2g062560Help
Entry
MTR_2g062560      CDS       T01716                                 

Definition
Beta-hexosaminidase subunit beta
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MTR_2g062560
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    MTR_2g062560
   00603 Glycosphingolipid biosynthesis - globo series
    MTR_2g062560
   00604 Glycosphingolipid biosynthesis - ganglio series
    MTR_2g062560
   00511 Other glycan degradation
    MTR_2g062560
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MTR_2g062560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 568 aa AA seqDB search
MLLQLLFLFLFFPFSTTSLNIWPKPRNLTWTPPHQTTLLSSTFTITTTTLHHNNHLTAAI
SRYTNLIKTEHNHPLIPPKTNLSNNLPPLQTLTITITNPNTELNHATDESYTLIITTPTA
TLTAVTSWGAMHGLETFSQLAWGNPTRVAVNVRVNDAPLFGHRGIMLDTSRNYYPVKDLL
RTIEAMSMNKLNVFHWHVTDSHSFPLILPSEPMLAEKGAYDVDMVYTVDDVKRVVEFGLD
RGVRVIPEIDAPGHTGSWALAYPDIVACANMFWWPAGSDWPDRLAAEPGTGHLNPLNPKT
YQVLKNVIRDVTTLFPEQFYHSGADEVVPGCWKTDPTIQKFLSNNGTLSQVLETFINNTL
PFILSLNRTVVYWEDVLLDDTVHVPSTILPKEHVILQTWNNGHNNTKRIVSSGYRAIVSS
SDFYYLDCGHGDFTGNNSIYDNQTGSDKNDGGSWCGPFKTWQNIYNYDITYGLTEEEAKL
VLGGEVALWSEQADETVLDSRLWPRTSAMAESLWSGNRDEKGLKRYAEATDRLNEWRSRM
VSRGIGAEPIQPLWCVRNPGMCNTVHAI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgttactacaattactattcttattcctgttctttccattttcaacaacatcattaaac
atatggccaaaaccaagaaacctcacgtggaccccaccacatcaaaccaccctcctctca
tcaacattcaccatcactaccaccactctccaccacaacaaccacctcaccgccgccata
tctcgctacacaaacctcatcaaaacagaacacaaccatcccttaatcccaccaaaaaca
aacctctcaaacaatctaccacctcttcaaaccctaacaataaccataacaaacccaaac
acagaactaaaccacgccaccgacgaatcctacacgttaataatcacaactcccaccgcc
accttaaccgctgtaacttcatggggagccatgcatggtttagaaacattctcacagctt
gcatggggaaacccaacgcgcgtggctgtgaacgtgcgtgttaacgacgcgccgttgttc
ggtcatcgcggtattatgttagatacttcaagaaactactatccagtgaaggatttgtta
agaactattgaagctatgagtatgaataagttgaatgtgtttcattggcatgtaactgat
tctcattcttttcctttgattcttccttctgaaccaatgttggctgagaaaggtgcttat
gatgttgatatggtttatactgttgatgatgttaaaagggttgttgaatttgggcttgat
cgtggtgttcgtgttatccctgagatcgatgctcctgggcatacaggatcatgggcctta
gcctaccctgacattgtagcatgtgccaacatgttctggtggccagctggaagtgattgg
cccgatcgtcttgcggcagaaccgggaacaggtcatttaaatcccttaaaccccaagacc
taccaagtcctgaagaatgtcatacgcgatgtaaccacattgttcccggaacaattttac
cattctggtgctgatgaagtcgtaccagggtgctggaaaaccgatccaacaattcagaaa
tttctatcaaataatggaactctcagccaagtccttgagacgtttatcaacaacactctc
cctttcattttatccctcaaccgtactgttgtctattgggaagatgttctattagacgat
acagtccatgttccatcgacgattctccctaaagaacatgtgattttgcagacatggaac
aatggacataacaacactaagaggatagtatcttctggataccgcgcaatcgtgtcatca
tccgacttctattatcttgactgtggacacggcgacttcactggaaataacagtatttac
gacaaccaaacaggaagtgacaaaaatgatggcggctcttggtgtggaccttttaaaaca
tggcaaaatatatacaattatgatataacttatggactgaccgaagaagaagcgaaattg
gttttaggtggggaggtagcgttgtggtcagaacaagccgatgaaactgttttggattcg
cggctttggcctagaacttctgcaatggctgagtcgttgtggtcaggcaatagggatgag
aagggtctgaagcgatacgcagaggcaacagatagattgaatgaatggcgaagcagaatg
gtgagtagaggtataggagctgagcctattcagccactttggtgtgttaggaaccctggt
atgtgcaacacagtacatgcaatctag

DBGET integrated database retrieval system