KEGG   Medicago truncatula (barrel medic): MTR_2g086980Help
Entry
MTR_2g086980      CDS       T01716                                 

Definition
OTU domain-containing protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 253 aa AA seqDB search
MQFSLLAYVDSWYFLTFLNRRKYVNPSWQVYGNNVEIQAMCEMYNRPIHIYSYSTEPINT
FHGSYDTDTPPVRLSFHHGNHYNSLVDPRRPTIGAGLGFSSLRGTNVDKDQVKAAIKSQQ
DQQIDNALLAEGRFYSDLELTEKEIELAVMEASRAEYLAGGTFKQQLGNRESSTSTAEPS
SSGARSSGSDPKMESGKGNNSNLSSSMNMLLSMGFSYLQAIEAYSIFGDDVDSMICYLLE
TGSSSRRKGKATE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttagtttgttggcttatgttgatagttggtactttttaacttttttgaatagg
cgtaaatatgttaacccttcctggcaggtttatgggaacaatgttgagatccaagccatg
tgtgaaatgtataatcgacctattcatatatactcctactccacagagcctatcaataca
tttcatggaagttatgacaccgatacgccaccagtacgcctaagttttcatcatggtaac
cattacaactcccttgttgacccacggcgtcccacaattggtgcaggactcgggttcagc
tctcttcgtgggacaaatgttgacaaagatcaagtcaaggctgctattaaatctcagcaa
gaccaacaaatcgataatgcacttttagctgaggggcggttttactctgatcttgagctc
acagagaaggaaattgaacttgccgtgatggaagcttctcgggctgaataccttgccggt
ggtacatttaagcaacaacttggcaatcgagagtcgtctacgtcaactgctgagccatct
tcctctggagcaagatcgtcaggtagtgatcccaagatggaaagtgggaaaggaaataat
tctaatcttagcagcagcatgaatatgttactatcgatgggatttagttacctgcaagca
attgaggcatacagcatatttggggatgatgttgattctatgatttgttacttgttggaa
actggcagcagtagcagacgtaaaggaaaggctactgaatga

DBGET integrated database retrieval system