KEGG   Medicago truncatula (barrel medic): MTR_2g086980Help
Entry
MTR_2g086980      CDS       T01716                                 

Definition
OTU domain-containing protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_2g086980
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   MTR_2g086980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 253 aa AA seqDB search
MQFSLLAYVDSWYFLTFLNRRKYVNPSWQVYGNNVEIQAMCEMYNRPIHIYSYSTEPINT
FHGSYDTDTPPVRLSFHHGNHYNSLVDPRRPTIGAGLGFSSLRGTNVDKDQVKAAIKSQQ
DQQIDNALLAEGRFYSDLELTEKEIELAVMEASRAEYLAGGTFKQQLGNRESSTSTAEPS
SSGARSSGSDPKMESGKGNNSNLSSSMNMLLSMGFSYLQAIEAYSIFGDDVDSMICYLLE
TGSSSRRKGKATE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttagtttgttggcttatgttgatagttggtactttttaacttttttgaatagg
cgtaaatatgttaacccttcctggcaggtttatgggaacaatgttgagatccaagccatg
tgtgaaatgtataatcgacctattcatatatactcctactccacagagcctatcaataca
tttcatggaagttatgacaccgatacgccaccagtacgcctaagttttcatcatggtaac
cattacaactcccttgttgacccacggcgtcccacaattggtgcaggactcgggttcagc
tctcttcgtgggacaaatgttgacaaagatcaagtcaaggctgctattaaatctcagcaa
gaccaacaaatcgataatgcacttttagctgaggggcggttttactctgatcttgagctc
acagagaaggaaattgaacttgccgtgatggaagcttctcgggctgaataccttgccggt
ggtacatttaagcaacaacttggcaatcgagagtcgtctacgtcaactgctgagccatct
tcctctggagcaagatcgtcaggtagtgatcccaagatggaaagtgggaaaggaaataat
tctaatcttagcagcagcatgaatatgttactatcgatgggatttagttacctgcaagca
attgaggcatacagcatatttggggatgatgttgattctatgatttgttacttgttggaa
actggcagcagtagcagacgtaaaggaaaggctactgaatga

DBGET integrated database retrieval system