KEGG   Medicago truncatula (barrel medic): MTR_2g087710Help
Entry
MTR_2g087710      CDS       T01716                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 USP7_C2 DUSP
Motif
Other DBs
NCBI-GeneID: 11422624
NCBI-ProteinID: XP_003596922
UniProt: G7IRH1
Position
2
AA seq 894 aa AA seqDB search
MECSSEDSSDNTQKPDSNNNNNNQRVYFVPHRWWKDAQDAMPVDLDKKKGIVYASSPGSS
YGPMKIINNIFSSDLVFNLQREEESRNILENGEVGVSGRDFALVSGDMWLQALKWHSDSK
NATKDDKGFSATDTDMGDVYPLQLRLSVQRETNSFEVRISKKDNTVELYKRACKLFSVDS
EMLRILDYSGHITLLFSDGENHVPTDFQRQSDQENLLELQVYGLSDSMRCREGKKDSGSA
SMKMNGTADCTRASSLTFCLGPGEAGSLGLTGLQNLGNTCFMNSSLQCLTHTPKLVDYFL
EDYSREINSDNPLGMNGEIASAFGDLLRKLWAPGASPVAPRMFKSKLARFAPQFSGFNQH
DSQELLAFLLDGLHEDLNRVKCKPYVEAKDGDGRPDEEVADEYWNYHLARNDSVIVDVCQ
GQYKSTLVCPVCRKVSVTFDPFMYLSLPLPSTTMRTMTLTVVSNTCDGMSQLSPYTISVP
KHGKFEDLTRALSTACSLGPDEALLVAEVYNNRIIRFLEDPADSLSLIRDADKLVAYRFP
KDNVDTPLVVFINQRMEEQYIYGKLAPNWKAFGIPVVASLCNIVNGSDLRNLYLKWFHPL
QDLIEETLESCVVSERTEEVAEIEGVADSGSDTIVNGLDTPSDGEMEFYITDDKGTVKNS
KILMNEPLTVNGGLNPLHVLVCWSEKQIKKYDTQLSSSLPEVCKSSFLAKRPQEPVSLYK
CLETFLQEEPLGPEDMWYCPGCKNHRQASKKLDLWRLPEILVIHLKRFQYSRFMKNKLET
LVDFPVDNLDLSSYITHGNQKSYHYTLYAISNHFGSMGGGHYTAFVHHGGDQWYDFDDSR
VYPISKEKIKSSAAYVLFYRRVSERVNPGAKIRFLPCDLVFRGSSYRNSFCSCS
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggagtgttcctcagaagattcttcagataacactcaaaaaccagactcaaacaacaac
aacaacaatcaacgagtttattttgttcctcacaggtggtggaaggatgcacaagatgca
atgccagtggatttggataagaagaaggggattgtatatgcatcttcgccgggttcatca
tacggtcctatgaagataattaacaacatcttcagctcagatctcgtgtttaatcttcag
agagaggaagaatcacggaacattctggaaaatggtgaagtgggtgtttctggtagggat
tttgctttggtttctggtgatatgtggttgcaggcactcaagtggcatagtgattcaaaa
aatgcaacgaaagatgacaaaggcttttcagcaaccgacactgatatgggagatgtatat
cctttacagctcaggctttctgttcaaagggaaacaaattcctttgaagtaagaataagc
aaaaaggacaatacagttgagctttataaaagagcctgcaaactgttcagtgtggattca
gagatgttacgcattttggactattcaggccatataaccttgctttttagtgatggcgaa
aatcatgtgcccacagactttcaaaggcagtctgatcaggagaatcttctggaattgcaa
gtttatgggttgtcagactcaatgagatgtagggaagggaaaaaagattctggcagtgct
tcaatgaagatgaatggtactgctgattgtacgcgtgcgagttctttgacattctgttta
ggccctggtgaagctggttccttgggactaactggattacaaaacctaggaaatacttgc
tttatgaacagttcccttcagtgcttaacacatacgccgaagcttgttgactattttctg
gaagattatagtagagaaatcaattctgacaacccattgggcatgaatggtgagatagcg
tcggcgtttggagatttacttaggaagttatgggctcctggcgcaagtcctgtggcacca
aggatgttcaaatcaaagcttgctagatttgcacctcagtttagtgggtttaatcagcat
gattcccaagagcttcttgcatttttattggacggacttcatgaagatttaaatcgtgtt
aaatgtaagccttacgtagaagcaaaggatggagatggtcgaccagatgaagaagttgcc
gatgaatattggaattatcatttggctcgcaatgattcagtcattgttgatgtgtgccaa
ggccaatataaatcaacgttagtttgtcctgtttgtaggaaggtgtctgtgacatttgat
ccattcatgtacttatcattgcccctaccttcaacaacaatgcggacaatgactttaacc
gttgttagtaacacttgtgatggaatgtctcaattatcaccatatacaatttctgttcca
aaacatggaaaatttgaagatcttactcgtgctcttagcactgcatgctctttgggacct
gacgaggctttattagtagccgaggtatacaacaaccgcatcatacgtttccttgaagat
ccagctgattcattatcattgatcagagatgctgacaaactagttgcttaccgatttccg
aaagataatgtggatacccctctcgtcgtctttataaaccaacgaatggaggagcaatat
atctacgggaaattggctccaaattggaaggcatttggaattcctgttgtggctagtctc
tgtaatattgtaaatggatctgatctccgcaatttgtatctgaagtggttccatccatta
caagatttgatcgaagaaactttagagagttgtgttgtgtctgagagaacggaagaagtt
gcggaaattgaaggcgttgcagattctggttcagataccattgtaaatgggttagatacg
ccttcagatggagaaatggagttctacataacagatgataaggggactgtcaagaattcc
aaaatattaatgaatgagccacttacagtaaatggagggttaaatccgctgcacgtgctt
gtatgttggtcagaaaaacagattaaaaaatatgacacccagctttctagttcgttgcct
gaggtctgcaagtctagctttttagcaaagagacctcaagaaccagtttctctgtataag
tgccttgaaacattcttgcaagaagaacctcttggaccagaagacatgtggtattgtcct
ggctgtaaaaatcatcgtcaagctagcaagaagttagatctttggagacttcctgaaatt
ttggtcattcatctcaagaggtttcaatatagtcgattcatgaaaaacaagctggagaca
ttggttgacttccctgtggataatcttgatttgtcatcttatattacccatgggaaccag
aagtcttatcattacacactttatgctatcagtaaccattttggaagcatggggggtggt
cattataccgcatttgtacatcatggtggggatcaatggtatgactttgatgatagccgt
gtctatcccatcagcaaggagaagataaagtcgtcagctgcctatgttcttttctacaga
agagtttcagaaagggtgaaccctggtgcaaagataagattccttccctgtgacctggtc
ttcagaggatccagttacagaaatagtttctgctcatgcagttaa

DBGET integrated database retrieval system